Protein Family IF08471

Metagenome Isolate
117 Members
65 Samples
98 Scaffolds
157.56 Avg Length

🧬 Representative Sequence

ID
3300042620|Ga0466728_443831|Ga0466728_443831_10011_10580
Length
189 aa
Sequence
MRLLLGKKTIFSCKIKITEYICFPKKTKMIQEIERKFLVSGDFKPFVSESIRIAQAYLSSVPERTVRVRIKGDKGYITVKGIAGDSGVSRFEWEKEIPLSEAQELLKICEPGVIDKTRHLILAGNHTFEVDEFHGENEGLIIAEIELDSEDEPFEKPFWLGREVTGDAEYYNSMLMKNPYIKWRTASRL

📊 Sample Types

Isolate 16.2%
Metagenome 83.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.3%
Kalotermitidae 20.0%
Unclassified 15.4%
Blattidae 9.2%
Rhinotermitidae 6.2%
Apidae 4.6%
Passalidae 4.6%
Elmidae 3.1%
Hodotermitidae 1.5%
Tenebrionidae 1.5%
Drosophilidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 106
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
2 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
5 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
6 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
7 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
8 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
14 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
15 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
16 2922326829 Bacteroides sp. 224 Isolate Blattidae
17 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
18 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
19 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
20 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
21 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
22 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
23 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
24 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
25 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
26 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
27 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
28 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
29 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
30 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
31 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
32 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
33 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
34 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
35 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
36 2785510743 Apibacter sp. ESL0404 Isolate Apidae
37 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
38 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
39 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
40 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
41 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
42 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
43 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
44 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
45 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
46 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
47 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
48 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
49 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
50 2799112231 Apibacter sp. ESL0432 Isolate Unclassified
51 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
52 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
53 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
54 3004667792 Bacteroides sp. 519 Isolate Blattidae
55 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
56 2832298047 Apibacter sp. wkB309 Isolate Apidae
57 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
58 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
59 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
60 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
61 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
62 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
63 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
64 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
65 3300005316 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut Metagenome Drosophilidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_053780 3300042659 Bacteria 2582
2 Ga0466733_202133 3300042659 Bacteria 5014
3 Ga0123357_10004689 3300009784 Bacteria 16145
4 Ga0123356_10330376 3300010049 Bacteria 1641
5 Ga0123356_10620659 3300010049 Unclassified 1247
6 Ga0123353_10287169 3300010167 Unclassified 2521
7 Ga0466690_392368 3300042590 Bacteria 11841
8 Ga0466706_156116 3300042599 Bacteria 30046
9 Ga0466713_035594 3300042602 Bacteria 13747
10 Ga0466716_095419 3300042605 Bacteria 3826
11 Ga0466722_109950 3300042609 Bacteria 8778
12 Ga0466730_001511 3300042625 Bacteria 4025
13 Ga0123355_10384354 3300009826 Bacteria 1826
14 Ga0123356_10471102 3300010049 Bacteria 1407
15 Ga0123353_10845812 3300010167 Unclassified 1255
16 JGI24705J35276_12149923 3300002504 Bacteria 1178
17 Ga0466728_156336 3300042620 Bacteria 1326
18 Ga0466697_228790 3300042611 Bacteria 1095
19 Ga0466729_198321 3300042621 Bacteria 8895
20 Ga0466734_140707 3300042623 Bacteria 1030
21 Ga0466725_246159 3300042654 Bacteria 1463
22 Ga0123357_10010182 3300009784 Bacteria 11937
23 Ga0123356_12422671 3300010049 Bacteria 657
24 Ga0123353_10033243 3300010167 Bacteria 8027
25 Ga0123353_10267422 3300010167 Bacteria 2637
26 Ga0123354_10280813 3300010882 Bacteria 1617
27 HBC_ctgsDRAFT_1000036 3300000333 Bacteria 33162
28 JGI24695J34938_10373910 3300002450 Bacteria 630
29 Ga0466729_172709 3300042621 Bacteria 2625
30 Ga0466706_281467 3300042599 Bacteria 24001
31 Ga0466700_361949 3300042600 Bacteria 4355
32 Ga0466714_048622 3300042603 Bacteria 56206
33 Ga0466714_072449 3300042603 Bacteria 2332
34 Ga0466717_172510 3300042604 Bacteria 1564
35 Ga0466725_362383 3300042654 Bacteria 1727
36 Ga0123357_10019436 3300009784 Bacteria 9053
37 Ga0123357_10022743 3300009784 Bacteria 8409
38 Ga0123357_10613423 3300009784 Unclassified 827
39 Ga0123354_10031483 3300010882 Bacteria 8320
40 Ga0123354_10064274 3300010882 Unclassified 5383
41 Ga0123354_10231862 3300010882 Bacteria 1927
42 Ga0466692_052636 3300042591 Unclassified 1062
43 JGI24702J35022_10010712 3300002462 Bacteria 5120
44 Ga0074302_1155534 3300005316 Bacteria 711
45 Ga0466715_504379 3300042616 Bacteria 25514
46 Ga0466714_155862 3300042603 Bacteria 8190
47 Ga0466704_378204 3300042643 Bacteria 2757
48 Ga0466704_450066 3300042643 Bacteria 15714
49 Ga0123357_10215799 3300009784 Bacteria 2142
50 Ga0123356_12603645 3300010049 Unclassified 633
51 Ga0466691_107034 3300042593 Bacteria 1964
52 Ga0466696_121761 3300042596 Bacteria 1379
53 2227119145 2225789004 Unclassified 1709
54 Ga0068305_10185621 3300005083 Bacteria 1147
55 Ga0466711_111542 3300042615 Bacteria 1712
56 Ga0466715_115168 3300042616 Bacteria 14737
57 Ga0466723_287950 3300042618 Bacteria 10333
58 Ga0466700_454173 3300042600 Bacteria 3078
59 Ga0466713_072003 3300042602 Bacteria 72866
60 Ga0466722_180460 3300042609 Bacteria 23698
61 Ga0466698_109727 3300042610 Bacteria 2489
62 Ga0466733_094328 3300042659 Bacteria 1320
63 Ga0123357_10132665 3300009784 Bacteria 3094
64 Ga0123355_10021039 3300009826 Bacteria 10434
65 IMNBL1DRAFT_c0000452 3300000062 Bacteria 34320
66 JGI24702J35022_10034882 3300002462 Bacteria 2690
67 Ga0068305_10000024 3300005083 Bacteria 79054
68 Ga0466710_382177 3300042613 Bacteria 1302
69 Ga0466719_061695 3300042606 Bacteria 12823
70 Ga0466705_132153 3300042612 Bacteria 1390
71 Ga0466725_026613 3300042654 Bacteria 1672
72 Ga0562377_0004 3300056842 Bacteria 3525959
73 Ga0123357_10060854 3300009784 Bacteria 5063
74 Ga0123353_10000005 3300010167 Bacteria 308504
75 Ga0123353_11284869 3300010167 Bacteria 952
76 2227041492 2225789003 Unclassified 4198
77 JGI24702J35022_10001870 3300002462 Bacteria 12958
78 JGI24702J35022_10691978 3300002462 Bacteria 633
79 JGI24705J35276_12235256 3300002504 Bacteria 6341
80 JGI24705J35276_12236368 3300002504 Bacteria 7928
81 Ga0466712_265657 3300042614 Bacteria 2203
82 Ga0466728_443831 3300042620 Bacteria 12126
83 Ga0466700_381383 3300042600 Bacteria 7002
84 Ga0466700_411124 3300042600 Unclassified 2967
85 Ga0466713_016116 3300042602 Bacteria 46967
86 Ga0466713_109231 3300042602 Bacteria 188899
87 Ga0466704_244375 3300042643 Unclassified 1216
88 Ga0466724_56743 3300042649 Bacteria 1936
89 Ga0466708_049337 3300042652 Bacteria 27530
90 Ga0123357_10023323 3300009784 Bacteria 8313
91 Ga0123356_11297578 3300010049 Bacteria 891
92 Ga0123354_10325078 3300010882 Bacteria 1412
93 Ga0466657_100103 3300042582 Bacteria 2183
94 IMNBL1DRAFT_c0013460 3300000062 Bacteria 3667
95 Ga0466710_334256 3300042613 Bacteria 7504
96 Ga0466715_084192 3300042616 Bacteria 39268
97 Ga0466713_043591 3300042602 Bacteria 53812
98 Ga0466709_240386 3300042648 Bacteria 67601

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042599 Ga0466706_156116 Ga0466706_156116_22688_23146 152
2 3300042600 Ga0466700_361949 Ga0466700_361949_3651_4112 153
3 3300042652 Ga0466708_049337 Ga0466708_049337_2565_3026 153
4 iso_pr_bacteria 2922326829 2922327812 153
5 3300010049 Ga0123356_10330376 Ga0123356_103303762 154
6 3300010049 Ga0123356_10620659 Ga0123356_106206591 154
7 3300010049 Ga0123356_12603645 Ga0123356_126036451 154
8 3300042582 Ga0466657_100103 Ga0466657_100103_962_1426 154
9 3300042599 Ga0466706_281467 Ga0466706_281467_6040_6504 154
10 3300042603 Ga0466714_155862 Ga0466714_155862_5967_6431 154
11 3300042604 Ga0466717_172510 Ga0466717_172510_490_954 154
12 3300042606 Ga0466719_061695 Ga0466719_061695_7045_7509 154
13 3300042612 Ga0466705_132153 Ga0466705_132153_664_1128 154
14 3300042613 Ga0466710_334256 Ga0466710_334256_5133_5597 154
15 3300042649 Ga0466724_56743 Ga0466724_56743_1029_1493 154
16 3300042654 Ga0466725_246159 Ga0466725_246159_857_1321 154
17 3300002462 JGI24702J35022_10010712 JGI24702J35022_100107122 155
18 3300002504 JGI24705J35276_12149923 JGI24705J35276_121499231 155
19 3300010167 Ga0123353_10287169 Ga0123353_102871691 155
20 3300010167 Ga0123353_10845812 Ga0123353_108458122 155
21 3300010167 Ga0123353_11284869 Ga0123353_112848692 155
22 3300010882 Ga0123354_10064274 Ga0123354_100642743 155
23 3300042593 Ga0466691_107034 Ga0466691_107034_201_668 155
24 3300042596 Ga0466696_121761 Ga0466696_121761_233_700 155
25 3300042600 Ga0466700_411124 Ga0466700_411124_1557_2024 155
26 3300042602 Ga0466713_016116 Ga0466713_016116_41836_42303 155
27 3300042602 Ga0466713_043591 Ga0466713_043591_7063_7530 155
28 3300042602 Ga0466713_072003 Ga0466713_072003_46510_46977 155
29 3300042602 Ga0466713_109231 Ga0466713_109231_184857_185324 155
30 3300042609 Ga0466722_109950 Ga0466722_109950_5191_5658 155
31 3300042615 Ga0466711_111542 Ga0466711_111542_380_847 155
32 3300042621 Ga0466729_172709 Ga0466729_172709_44_511 155
33 3300042625 Ga0466730_001511 Ga0466730_001511_2096_2563 155
34 3300042643 Ga0466704_378204 Ga0466704_378204_1399_1866 155
35 3300042654 Ga0466725_362383 Ga0466725_362383_1180_1647 155
36 3300056842 Ga0562377_0004 Ga0562377_0004_679164_679631 155
37 iso_pr_bacteria 2820776227 2820777548 155
38 iso_pr_bacteria 3004667792 3004671687 155
39 2225789003 2227041492 2227401355 156
40 3300002462 JGI24702J35022_10001870 JGI24702J35022_100018708 156
41 3300002462 JGI24702J35022_10691978 JGI24702J35022_106919781 156
42 3300002504 JGI24705J35276_12236368 JGI24705J35276_122363683 156
43 3300005083 Ga0068305_10000024 Ga0068305_1000002411 156
44 3300009784 Ga0123357_10004689 Ga0123357_1000468911 156
45 3300009784 Ga0123357_10010182 Ga0123357_100101822 156
46 3300009784 Ga0123357_10019436 Ga0123357_100194362 156
47 3300009784 Ga0123357_10023323 Ga0123357_100233238 156
48 3300009784 Ga0123357_10060854 Ga0123357_100608542 156
49 3300009784 Ga0123357_10132665 Ga0123357_101326653 156
50 3300009784 Ga0123357_10215799 Ga0123357_102157993 156
51 3300009784 Ga0123357_10613423 Ga0123357_106134232 156
52 3300009826 Ga0123355_10384354 Ga0123355_103843542 156
53 3300010049 Ga0123356_10471102 Ga0123356_104711022 156
54 3300010049 Ga0123356_11297578 Ga0123356_112975781 156
55 3300010167 Ga0123353_10033243 Ga0123353_100332435 156
56 3300010167 Ga0123353_10267422 Ga0123353_102674225 156
57 3300010882 Ga0123354_10031483 Ga0123354_100314836 156
58 3300010882 Ga0123354_10231862 Ga0123354_102318622 156
59 3300010882 Ga0123354_10325078 Ga0123354_103250782 156
60 3300042600 Ga0466700_454173 Ga0466700_454173_1007_1477 156
61 3300042610 Ga0466698_109727 Ga0466698_109727_911_1381 156
62 3300042611 Ga0466697_228790 Ga0466697_228790_518_988 156
63 3300042613 Ga0466710_382177 Ga0466710_382177_421_891 156
64 3300042614 Ga0466712_265657 Ga0466712_265657_617_1087 156
65 3300042618 Ga0466723_287950 Ga0466723_287950_7836_8306 156
66 3300042621 Ga0466729_198321 Ga0466729_198321_2561_3031 156
67 3300042659 Ga0466733_202133 Ga0466733_202133_955_1425 156
68 iso_pr_bacteria 2695420931 2698111491 156
69 iso_pr_bacteria 2820746860 2820746907 156
70 iso_pr_bacteria 2820788205 2820789776 156
71 iso_pr_bacteria 2910942425 2910945039 156
72 3300000062 IMNBL1DRAFT_c0013460 IMNBL1DRAFT_00134602 157
73 3300002450 JGI24695J34938_10373910 JGI24695J34938_103739101 157
74 3300002462 JGI24702J35022_10034882 JGI24702J35022_100348823 157
75 3300002504 JGI24705J35276_12235256 JGI24705J35276_122352566 157
76 3300009826 Ga0123355_10021039 Ga0123355_100210398 157
77 3300010049 Ga0123356_12422671 Ga0123356_124226711 157
78 3300042603 Ga0466714_072449 Ga0466714_072449_1783_2256 157
79 3300042605 Ga0466716_095419 Ga0466716_095419_1179_1652 157
80 3300042623 Ga0466734_140707 Ga0466734_140707_27_500 157
81 3300042648 Ga0466709_240386 Ga0466709_240386_48165_48638 157
82 iso_pr_bacteria 2820768849 2820769288 157
83 iso_pr_bacteria 2820774381 2820774476 157
84 iso_pr_bacteria 2864878056 2864882042 157
85 iso_pr_bacteria 2864886855 2864890986 157
86 3300005316 Ga0074302_1155534 Ga0074302_11555342 158
87 3300009784 Ga0123357_10022743 Ga0123357_100227434 158
88 3300010167 Ga0123353_10000005 Ga0123353_10000005130 158
89 3300010882 Ga0123354_10280813 Ga0123354_102808132 158
90 3300042600 Ga0466700_381383 Ga0466700_381383_4854_5330 158
91 iso_pr_bacteria 2695420314 2695471493 158
92 iso_pr_bacteria 2785510743 2785736632 158
93 iso_pr_bacteria 2799112231 2799234589 158
94 iso_pr_bacteria 2832298047 2832299911 158
95 3300000333 HBC_ctgsDRAFT_1000036 HBC_ctgsDRAFT_10000365 159
96 3300005083 Ga0068305_10185621 Ga0068305_101856211 159
97 3300042591 Ga0466692_052636 Ga0466692_052636_564_1043 159
98 3300042602 Ga0466713_035594 Ga0466713_035594_168_647 159
99 3300042616 Ga0466715_115168 Ga0466715_115168_8662_9141 159
100 3300042659 Ga0466733_053780 Ga0466733_053780_124_603 159
101 iso_pr_bacteria 8100166142 8100169202 159
102 3300042609 Ga0466722_180460 Ga0466722_180460_17031_17513 160
103 3300042616 Ga0466715_504379 Ga0466715_504379_22794_23276 160
104 3300042643 Ga0466704_450066 Ga0466704_450066_9250_9732 160
105 3300042659 Ga0466733_094328 Ga0466733_094328_137_619 160
106 3300042620 Ga0466728_156336 Ga0466728_156336_610_1098 162
107 2225789004 2227119145 2227511262 163
108 3300000062 IMNBL1DRAFT_c0000452 IMNBL1DRAFT_000045234 164
109 3300042603 Ga0466714_048622 Ga0466714_048622_21897_22391 164
110 iso_pr_bacteria 2940193328 2940195654 164
111 iso_pr_bacteria 2940336608 2940338926 164
112 3300042643 Ga0466704_244375 Ga0466704_244375_50_589 166
113 iso_pr_bacteria 2910926975 2910928914 168
114 3300042590 Ga0466690_392368 Ga0466690_392368_10972_11487 171
115 3300042616 Ga0466715_084192 Ga0466715_084192_18144_18698 184
116 3300042654 Ga0466725_026613 Ga0466725_026613_858_1418 186
117 3300042620 Ga0466728_443831 Ga0466728_443831_10011_10580 189

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01928 CYTH CYTH domain 31 163 0.83

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.