Protein Family IF08465

Metagenome Isolate
152 Members
62 Samples
140 Scaffolds
466.62 Avg Length

🧬 Representative Sequence

ID
3300042620|Ga0466728_409369|Ga0466728_409369_3068_4564
Length
498 aa
Sequence
LRNSKSGWIKRLRQNPALQIRKKPMTRNNYAKVTAEIIEELRRIAGSGNVITSEEKLEAYSHDETDAAEYGSMPEAAVLPLTTEQAAAVVKLANRERIPVTPRGAGSGLSGGAIPEYGGIVVSLERMNRLIEIDRDNMAAVVEAGMVTNDFAQAVQAEGLFFAGYPMSLQTCVIGGNIAENAGGGKAVKYGVTGRYVLGLTLVTPSGDIVELGGKLAKDVTGYDLKSLIIGSEGTLGIVTKAIIRLIGYPASKSDLLVLFKTPKEAIDLVPLVLSRGINPTSIEFMDQLSIFTSCRYLNESLPYEGCGAMLLIELDGSDGVQIERDLVETGKLCEEKGALEVYVAEDRNNIERLWNVRRNIAEAFKVYSPIQSIEDIVVPISKIPAMIPELEKLGNRYGMQIPCYGHAGDGNLHATLVKDPAMSMEEWKRNEAACLGELYSLVSSFGGKISGEHGIGIKRRKYLKDLIAPAELALMRSLKRAWDPNNIMNPGKIFESP

📊 Sample Types

Isolate 7.9%
Metagenome 92.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 39.3%
Kalotermitidae 24.6%
Unclassified 19.7%
Rhinotermitidae 6.6%
Termopsidae 4.9%
Passalidae 1.6%
Blaberidae 1.6%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 13
Bacteria 130
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2773857690 Unclassified Methanomassiliicoccaceae Nt197P4bin30 Isolate Unclassified
2 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
3 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
4 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
5 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
6 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
7 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
8 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
9 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
10 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
11 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
12 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
13 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
14 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
15 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
16 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
17 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
18 2773857688 Unclassified Methanomassiliicoccaceae Nt197P3bin45 Isolate Unclassified
19 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
20 2820183396 Unclassified Planctomycetes Lab288P3bin214 Isolate Unclassified
21 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
22 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
23 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
24 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
25 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
26 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
29 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
30 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
31 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
32 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
33 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
34 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
35 2503904012 Sphaerochaeta coccoides SPN1, DSM 17374 Isolate Kalotermitidae
36 2772190975 Treponema sp. RmG30 Isolate Blaberidae
37 2773857697 Unclassified Methanomassiliicoccaceae Th196P4bin34 Isolate Unclassified
38 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
39 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
40 2773857681 Unclassified Methanomassiliicoccaceae Lab288P1bin114 Isolate Unclassified
41 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
42 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
43 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
44 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
45 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
46 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
47 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
48 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
49 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
50 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
51 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
52 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
53 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
54 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
55 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
56 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
57 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
58 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
59 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
60 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
61 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
62 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466703_101720 3300042636 Bacteria 1747
2 Ga0466704_184656 3300042643 Bacteria 5704
3 Ga0466708_310127 3300042652 Bacteria 11890
4 Ga0123353_10081822 3300010167 Archaea 5193
5 Ga0264413_112228 3300024493 Bacteria 9702
6 Ga0456237_0003908 3300041968 Bacteria 2401
7 Ga0466696_425714 3300042596 Bacteria 23033
8 Ga0466712_054024 3300042614 Bacteria 13818
9 Ga0466718_034562 3300042617 Unclassified 2853
10 Ga0466726_032098 3300042619 Bacteria 9520
11 Ga0466700_145874 3300042600 Bacteria 1837
12 Ga0466713_007749 3300042602 Bacteria 3691
13 Ga0466716_039506 3300042605 Bacteria 7334
14 Ga0466716_453615 3300042605 Bacteria 3324
15 AustNasuHG_c1000454 3300000089 Bacteria 14355
16 JGI24698J34947_10000226 3300002449 Bacteria 23328
17 JGI24698J34947_10001541 3300002449 Bacteria 12188
18 JGI24698J34947_10005293 3300002449 Bacteria 7079
19 JGI24702J35022_10059203 3300002462 Bacteria 2046
20 Ga0466697_075904 3300042611 Bacteria 3165
21 Ga0466704_045761 3300042643 Bacteria 13519
22 Ga0466709_129829 3300042648 Bacteria 9338
23 Ga0466708_412348 3300042652 Bacteria 7288
24 Ga0123353_10006953 3300010167 Bacteria 15211
25 Ga0123353_10123468 3300010167 Bacteria 4162
26 Ga0123353_10270777 3300010167 Bacteria 2617
27 Ga0466690_299307 3300042590 Bacteria 12999
28 Ga0466695_304165 3300042595 Bacteria 3123
29 Ga0466699_183927 3300042597 Bacteria 2717
30 Ga0466711_094892 3300042615 Bacteria 21125
31 Ga0466715_046880 3300042616 Bacteria 6653
32 Ga0466723_005459 3300042618 Unclassified 9795
33 Ga0466726_191841 3300042619 Bacteria 3874
34 Ga0466717_156109 3300042604 Bacteria 1536
35 Ga0466720_139327 3300042607 Bacteria 23939
36 Ga0466720_147469 3300042607 Bacteria 4303
37 JGI24698J34947_10031686 3300002449 Bacteria 2781
38 JGI24702J35022_10000196 3300002462 Archaea 32680
39 Ga0466733_158356 3300042659 Bacteria 3787
40 Ga0123353_10000138 3300010167 Unclassified 88507
41 Ga0123353_10002903 3300010167 Archaea 21470
42 Ga0123353_10018361 3300010167 Bacteria 10339
43 Ga0123353_10129345 3300010167 Bacteria 4054
44 Ga0264413_133103 3300024493 Bacteria 6542
45 Ga0466696_101606 3300042596 Bacteria 5494
46 Ga0466712_194173 3300042614 Bacteria 12130
47 Ga0466715_390824 3300042616 Bacteria 4339
48 Ga0466729_042451 3300042621 Bacteria 4155
49 2227386343 2225789004 Archaea 27537
50 AustNasuHG_c1004345 3300000089 Bacteria 5081
51 JGI24698J34947_10001765 3300002449 Bacteria 11528
52 Ga0072940_1051651 3300005200 Bacteria 2593
53 Ga0466727_010760 3300042655 Bacteria 16422
54 Ga0123355_10296869 3300009826 Bacteria 2209
55 Ga0123356_10083897 3300010049 Bacteria 3019
56 Ga0123353_10001618 3300010167 Bacteria 27727
57 Ga0123353_10015609 3300010167 Archaea 11049
58 Ga0466718_058236 3300042617 Bacteria 6487
59 Ga0466723_092640 3300042618 Bacteria 22958
60 Ga0466726_285510 3300042619 Bacteria 3685
61 Ga0466728_409369 3300042620 Bacteria 5303
62 Ga0466706_204935 3300042599 Bacteria 2812
63 Ga0466713_072124 3300042602 Bacteria 12482
64 Ga0466713_122100 3300042602 Bacteria 19669
65 Ga0466719_160387 3300042606 Bacteria 9209
66 Ga0466720_179782 3300042607 Bacteria 9256
67 JGI24698J34947_10012162 3300002449 Bacteria 4723
68 JGI24705J35276_12236945 3300002504 Archaea 9380
69 Ga0068302_10537015 3300005071 Bacteria 2950
70 Ga0466731_000646 3300042622 Bacteria 5626
71 Ga0466708_443958 3300042652 Bacteria 29019
72 Ga0466727_077530 3300042655 Bacteria 2134
73 Ga0466656_378098 3300042550 Bacteria 11864
74 Ga0466692_053633 3300042591 Bacteria 26307
75 Ga0466691_212592 3300042593 Bacteria 3868
76 Ga0466715_006883 3300042616 Bacteria 4851
77 Ga0466715_265694 3300042616 Bacteria 8468
78 Ga0466715_293459 3300042616 Bacteria 1849
79 Ga0466715_339215 3300042616 Bacteria 7118
80 Ga0466723_060318 3300042618 Bacteria 4839
81 Ga0466726_032485 3300042619 Bacteria 3957
82 Ga0466726_275296 3300042619 Bacteria 3335
83 Ga0466728_261982 3300042620 Bacteria 12341
84 Ga0466700_000496 3300042600 Bacteria 2501
85 Ga0466707_015463 3300042601 Bacteria 5854
86 Ga0466716_285335 3300042605 Bacteria 3003
87 Ga0074263_113373 3300005485 Bacteria 2953
88 Ga0123357_10000921 3300009784 Bacteria 29858
89 Ga0466727_019169 3300042655 Bacteria 6986
90 Ga0466692_180683 3300042591 Bacteria 6544
91 Ga0466694_109741 3300042594 Bacteria 2685
92 Ga0466696_204934 3300042596 Bacteria 4310
93 Ga0466699_149725 3300042597 Bacteria 3341
94 Ga0466705_395615 3300042612 Bacteria 4188
95 Ga0466712_075804 3300042614 Bacteria 38150
96 Ga0466723_035396 3300042618 Bacteria 6943
97 Ga0466723_169486 3300042618 Bacteria 9216
98 Ga0466726_359327 3300042619 Bacteria 15666
99 Ga0466726_365204 3300042619 Bacteria 6611
100 Ga0466716_057586 3300042605 Bacteria 2056
101 Ga0466722_073652 3300042609 Bacteria 7007
102 JGI24698J34947_10008006 3300002449 Unclassified 5801
103 Ga0466703_227715 3300042636 Bacteria 6797
104 Ga0466703_332040 3300042636 Bacteria 7896
105 Ga0466708_145254 3300042652 Bacteria 3678
106 Ga0466708_199560 3300042652 Bacteria 6124
107 Ga0123353_10027889 3300010167 Archaea 8663
108 Ga0123353_10487894 3300010167 Unclassified 1800
109 Ga0264413_112229 3300024493 Bacteria 7681
110 Ga0466657_138406 3300042582 Archaea 13828
111 Ga0466690_252768 3300042590 Bacteria 3523
112 Ga0466692_122999 3300042591 Bacteria 1703
113 Ga0466695_328004 3300042595 Bacteria 2585
114 Ga0466712_088559 3300042614 Bacteria 13759
115 Ga0466711_135544 3300042615 Bacteria 26216
116 Ga0466718_047698 3300042617 Bacteria 18884
117 Ga0466723_005019 3300042618 Bacteria 8566
118 Ga0466716_208678 3300042605 Bacteria 18568
119 Ga0466722_154238 3300042609 Bacteria 15806
120 JGI24698J34947_10018663 3300002449 Unclassified 3746
121 Ga0466709_274175 3300042648 Bacteria 3723
122 Ga0123356_10032269 3300010049 Bacteria 4900
123 Ga0123353_10002960 3300010167 Unclassified 21250
124 Ga0123354_10052469 3300010882 Bacteria 6143
125 Ga0466657_328821 3300042582 Archaea 5575
126 Ga0466696_154130 3300042596 Bacteria 3437
127 Ga0466699_002401 3300042597 Bacteria 74503
128 Ga0466699_061048 3300042597 Bacteria 16540
129 Ga0466699_387540 3300042597 Bacteria 2910
130 Ga0466712_183925 3300042614 Bacteria 19044
131 Ga0466718_032678 3300042617 Bacteria 5435
132 Ga0466728_046550 3300042620 Bacteria 11889
133 Ga0466728_142258 3300042620 Bacteria 12593
134 Ga0466729_069366 3300042621 Bacteria 4817
135 Ga0466707_102120 3300042601 Bacteria 15647
136 Ga0466713_144820 3300042602 Bacteria 3116
137 Ga0466720_002207 3300042607 Unclassified 5736
138 2227441919 2225789004 Unclassified 5490
139 JGI24698J34947_10002323 3300002449 Bacteria 10218
140 Ga0074263_108249 3300005485 Bacteria 1876

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042604 Ga0466717_156109 Ga0466717_156109_248_1519 423
2 iso_pr_bacteria 2781125694 2781436867 423
3 3300042617 Ga0466718_034562 Ga0466718_034562_866_2278 433
4 3300042617 Ga0466718_047698 Ga0466718_047698_871_2283 433
5 3300042609 Ga0466722_073652 Ga0466722_073652_2718_4133 434
6 3300042614 Ga0466712_088559 Ga0466712_088559_2813_4228 435
7 3300041968 Ga0456237_0003908 Ga0456237_0003908_778_2160 436
8 3300042591 Ga0466692_180683 Ga0466692_180683_1871_3253 436
9 3300042600 Ga0466700_000496 Ga0466700_000496_1063_2469 436
10 3300042619 Ga0466726_191841 Ga0466726_191841_1644_3062 436
11 3300042655 Ga0466727_077530 Ga0466727_077530_224_1645 436
12 3300042601 Ga0466707_015463 Ga0466707_015463_2381_3805 438
13 3300042616 Ga0466715_046880 Ga0466715_046880_2578_3996 438
14 3300042652 Ga0466708_145254 Ga0466708_145254_2075_3502 438
15 3300042614 Ga0466712_054024 Ga0466712_054024_4318_5751 441
16 3300042614 Ga0466712_075804 Ga0466712_075804_11317_12750 441
17 3300002449 JGI24698J34947_10000226 JGI24698J34947_100002263 442
18 3300002449 JGI24698J34947_10001541 JGI24698J34947_100015414 442
19 3300002449 JGI24698J34947_10005293 JGI24698J34947_100052934 442
20 3300002449 JGI24698J34947_10008006 JGI24698J34947_100080063 442
21 3300002449 JGI24698J34947_10012162 JGI24698J34947_100121622 442
22 3300002449 JGI24698J34947_10018663 JGI24698J34947_100186633 442
23 3300042591 Ga0466692_122999 Ga0466692_122999_113_1525 442
24 3300042614 Ga0466712_194173 Ga0466712_194173_2478_3911 442
25 3300002449 JGI24698J34947_10002323 JGI24698J34947_100023237 443
26 3300042616 Ga0466715_390824 Ga0466715_390824_1024_2442 443
27 3300002449 JGI24698J34947_10001765 JGI24698J34947_100017657 444
28 3300042607 Ga0466720_179782 Ga0466720_179782_1315_2742 444
29 3300042648 Ga0466709_274175 Ga0466709_274175_2199_3620 444
30 3300042614 Ga0466712_183925 Ga0466712_183925_681_2126 447
31 3300042643 Ga0466704_184656 Ga0466704_184656_1914_3332 447
32 3300002449 JGI24698J34947_10031686 JGI24698J34947_100316862 448
33 3300042591 Ga0466692_053633 Ga0466692_053633_6500_7918 448
34 3300042616 Ga0466715_293459 Ga0466715_293459_13_1359 448
35 3300042607 Ga0466720_002207 Ga0466720_002207_10_1368 452
36 3300042621 Ga0466729_069366 Ga0466729_069366_1294_2706 452
37 3300010167 Ga0123353_10018361 Ga0123353_100183615 453
38 3300042621 Ga0466729_042451 Ga0466729_042451_2659_4053 464
39 3300000089 AustNasuHG_c1004345 AustNasuHG_10043452 465
40 3300042597 Ga0466699_061048 Ga0466699_061048_11578_12975 465
41 3300042597 Ga0466699_183927 Ga0466699_183927_1004_2401 465
42 3300042611 Ga0466697_075904 Ga0466697_075904_537_1943 468
43 3300002462 JGI24702J35022_10059203 JGI24702J35022_100592032 469
44 3300010167 Ga0123353_10123468 Ga0123353_101234682 469
45 3300042595 Ga0466695_328004 Ga0466695_328004_1156_2565 469
46 3300042600 Ga0466700_145874 Ga0466700_145874_127_1536 469
47 3300042602 Ga0466713_072124 Ga0466713_072124_5408_6817 469
48 3300042622 Ga0466731_000646 Ga0466731_000646_4035_5444 469
49 3300042652 Ga0466708_412348 Ga0466708_412348_1575_2984 469
50 iso_pr_bacteria 2781125630 2781267418 469
51 iso_pr_bacteria 2781125688 2781423280 469
52 3300005071 Ga0068302_10537015 Ga0068302_105370152 470
53 3300010882 Ga0123354_10052469 Ga0123354_100524694 470
54 3300024493 Ga0264413_133103 Ga0264413_1331031 470
55 3300042607 Ga0466720_139327 Ga0466720_139327_5891_7303 470
56 3300042615 Ga0466711_135544 Ga0466711_135544_23814_25226 470
57 3300000089 AustNasuHG_c1000454 AustNasuHG_100045410 471
58 3300009826 Ga0123355_10296869 Ga0123355_102968692 471
59 3300042590 Ga0466690_299307 Ga0466690_299307_3051_4466 471
60 3300042596 Ga0466696_101606 Ga0466696_101606_1211_2626 471
61 3300042596 Ga0466696_154130 Ga0466696_154130_1526_2941 471
62 3300042596 Ga0466696_204934 Ga0466696_204934_1740_3155 471
63 3300042605 Ga0466716_039506 Ga0466716_039506_3888_5303 471
64 3300042605 Ga0466716_208678 Ga0466716_208678_4481_5896 471
65 3300042606 Ga0466719_160387 Ga0466719_160387_4073_5488 471
66 3300042618 Ga0466723_005459 Ga0466723_005459_8281_9696 471
67 3300042618 Ga0466723_035396 Ga0466723_035396_2245_3660 471
68 3300042618 Ga0466723_169486 Ga0466723_169486_7328_8743 471
69 3300042619 Ga0466726_032485 Ga0466726_032485_2407_3822 471
70 3300042619 Ga0466726_285510 Ga0466726_285510_475_1890 471
71 3300042619 Ga0466726_359327 Ga0466726_359327_144_1559 471
72 3300042619 Ga0466726_365204 Ga0466726_365204_3309_4724 471
73 3300042652 Ga0466708_310127 Ga0466708_310127_3338_4753 471
74 3300042655 Ga0466727_010760 Ga0466727_010760_6982_8397 471
75 3300042655 Ga0466727_019169 Ga0466727_019169_261_1676 471
76 iso_pr_bacteria 2503904012 2503957819 471
77 3300042596 Ga0466696_425714 Ga0466696_425714_18279_19697 472
78 3300042597 Ga0466699_002401 Ga0466699_002401_67374_68792 472
79 3300042601 Ga0466707_102120 Ga0466707_102120_4002_5420 472
80 3300042602 Ga0466713_122100 Ga0466713_122100_8645_10063 472
81 3300042618 Ga0466723_092640 Ga0466723_092640_11092_12510 472
82 3300042636 Ga0466703_101720 Ga0466703_101720_213_1631 472
83 3300042636 Ga0466703_332040 Ga0466703_332040_4249_5667 472
84 3300042602 Ga0466713_007749 Ga0466713_007749_1582_3003 473
85 3300042605 Ga0466716_057586 Ga0466716_057586_560_1981 473
86 3300042616 Ga0466715_339215 Ga0466715_339215_1582_3003 473
87 3300042618 Ga0466723_005019 Ga0466723_005019_3018_4439 473
88 3300042620 Ga0466728_142258 Ga0466728_142258_8010_9431 473
89 3300042652 Ga0466708_443958 Ga0466708_443958_24228_25649 473
90 3300005200 Ga0072940_1051651 Ga0072940_10516512 474
91 3300042602 Ga0466713_144820 Ga0466713_144820_1071_2495 474
92 3300042612 Ga0466705_395615 Ga0466705_395615_2585_4009 474
93 3300042615 Ga0466711_094892 Ga0466711_094892_9748_11172 474
94 3300010167 Ga0123353_10006953 Ga0123353_100069533 475
95 3300042590 Ga0466690_252768 Ga0466690_252768_232_1659 475
96 3300042593 Ga0466691_212592 Ga0466691_212592_2030_3457 475
97 3300042609 Ga0466722_154238 Ga0466722_154238_5378_6805 475
98 3300042616 Ga0466715_265694 Ga0466715_265694_480_1907 475
99 3300042617 Ga0466718_032678 Ga0466718_032678_3981_5408 475
100 3300042618 Ga0466723_060318 Ga0466723_060318_2116_3543 475
101 3300042619 Ga0466726_032098 Ga0466726_032098_5840_7267 475
102 3300042620 Ga0466728_046550 Ga0466728_046550_1120_2547 475
103 3300042636 Ga0466703_227715 Ga0466703_227715_2765_4192 475
104 3300042643 Ga0466704_045761 Ga0466704_045761_11901_13328 475
105 iso_pr_bacteria 2772190975 2773724198 475
106 3300010167 Ga0123353_10487894 Ga0123353_104878942 476
107 3300042652 Ga0466708_199560 Ga0466708_199560_2501_3931 476
108 3300042659 Ga0466733_158356 Ga0466733_158356_1710_3140 476
109 iso_pu_archaea 2773857681 2774153563 476
110 iso_pu_archaea 2773857697 2774174522 476
111 2225789004 2227386343 2227831074 477
112 2225789004 2227441919 2227880395 477
113 3300002462 JGI24702J35022_10000196 JGI24702J35022_1000019616 477
114 3300002504 JGI24705J35276_12236945 JGI24705J35276_122369457 477
115 3300010167 Ga0123353_10015609 Ga0123353_100156099 477
116 3300010167 Ga0123353_10027889 Ga0123353_100278893 477
117 3300010167 Ga0123353_10129345 Ga0123353_101293454 477
118 3300010167 Ga0123353_10270777 Ga0123353_102707773 477
119 3300042594 Ga0466694_109741 Ga0466694_109741_94_1527 477
120 3300042595 Ga0466695_304165 Ga0466695_304165_550_1983 477
121 3300042620 Ga0466728_261982 Ga0466728_261982_9382_10815 477
122 iso_pr_bacteria 2781125652 2781312489 477
123 iso_pr_bacteria 2820183396 2820185066 477
124 3300010167 Ga0123353_10001618 Ga0123353_1000161816 478
125 3300010167 Ga0123353_10002960 Ga0123353_1000296010 478
126 3300042597 Ga0466699_149725 Ga0466699_149725_309_1745 478
127 3300042597 Ga0466699_387540 Ga0466699_387540_1138_2574 478
128 3300010049 Ga0123356_10032269 Ga0123356_100322692 479
129 3300024493 Ga0264413_112228 Ga0264413_1122286 479
130 3300024493 Ga0264413_112229 Ga0264413_1122295 479
131 3300042582 Ga0466657_328821 Ga0466657_328821_3140_4579 479
132 3300042599 Ga0466706_204935 Ga0466706_204935_1321_2760 479
133 3300042605 Ga0466716_285335 Ga0466716_285335_1417_2856 479
134 3300042605 Ga0466716_453615 Ga0466716_453615_1081_2520 479
135 3300042617 Ga0466718_058236 Ga0466718_058236_535_1974 479
136 3300042619 Ga0466726_275296 Ga0466726_275296_56_1495 479
137 3300042648 Ga0466709_129829 Ga0466709_129829_265_1704 479
138 3300005485 Ga0074263_108249 Ga0074263_1082492 480
139 3300005485 Ga0074263_113373 Ga0074263_1133733 480
140 iso_pu_archaea 2773857688 2774161698 480
141 iso_pu_archaea 2773857690 2774164730 480
142 3300010049 Ga0123356_10083897 Ga0123356_100838973 482
143 3300010167 Ga0123353_10000138 Ga0123353_1000013823 482
144 3300010167 Ga0123353_10002903 Ga0123353_1000290321 485
145 3300042550 Ga0466656_378098 Ga0466656_378098_8225_9682 485
146 3300042582 Ga0466657_138406 Ga0466657_138406_8953_10410 485
147 iso_pr_bacteria 2781125666 2781344562 485
148 3300009784 Ga0123357_10000921 Ga0123357_1000092119 486
149 3300042616 Ga0466715_006883 Ga0466715_006883_2138_3607 489
150 3300042607 Ga0466720_147469 Ga0466720_147469_237_1709 490
151 3300010167 Ga0123353_10081822 Ga0123353_100818228 494
152 3300042620 Ga0466728_409369 Ga0466728_409369_3068_4564 498

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01565 FAD_binding_4 FAD binding domain 74 213 0.99
PF02913 FAD-oxidase_C FAD linked oxidases, C-terminal domain 250 494 0.95

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01565 GO:0050660 flavin adenine dinucleotide binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.