Protein Family IF08441
Metagenome
Isolate
158
Members
64
Samples
151
Scaffolds
217.96
Avg Length
Representative Sequence
- ID
- 3300042620|Ga0466728_255153|Ga0466728_255153_4015_4818
- Length
- 267 aa
- Sequence
- MTKKLPVSGVSVRKIALNHLLNLSAFALCEYINGLCNIKISCTFVKISLIMSAIIAPSLLSANFLRLEEEIAMVNRSDADWLHLDVMDGVFVPNISLGFPMIKQLAQIITKPLDVHLMIVEPQKFIPFFGELGASSLGVHYEACTHLHRIIMQIKEAGMKACVVLNPHTPVELLSDILEDIDMVLIMSVNPGFSGQRFIPRTVDKIRRLKEMIVSRGLKILIEVDGGVNLERGKLLVEAGADVLVAGNFIFNADNPLELIRRMKQEI
Sample Types
Isolate
4.4%
Metagenome
95.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.7%
Kalotermitidae
22.2%
Unclassified
12.7%
Formicidae
6.3%
Rhinotermitidae
4.8%
Passalidae
4.8%
Termopsidae
4.8%
Blattidae
1.6%
Hodotermitidae
1.6%
Anaplectidae
1.6%
Taxonomy
Archaea
0
Bacteria
153
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 646311912 | Blattabacterium sp. BPLAN | Isolate | Blattidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 10 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 13 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 14 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 20 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 24 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 32 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 33 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 34 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 35 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 36 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 37 | 2561511170 | Blattabacterium sp. (Blatta orientalis) Tarazona | Isolate | Unclassified |
| 38 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 39 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 45 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 46 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 47 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 48 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 49 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 50 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 51 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 52 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 53 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 54 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 55 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 56 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 57 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 58 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 59 | 3001995955 | Blattabacterium cuenoti ANAPcal | Isolate | Anaplectidae |
| 60 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 61 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 62 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 63 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 64 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_260838 | 3300042614 | Bacteria | 1163 |
| 2 | Ga0466711_152157 | 3300042615 | Bacteria | 50470 |
| 3 | Ga0466718_146506 | 3300042617 | Bacteria | 1412 |
| 4 | Ga0466728_255153 | 3300042620 | Bacteria | 9509 |
| 5 | Ga0466728_460464 | 3300042620 | Unclassified | 2165 |
| 6 | Ga0466734_027745 | 3300042623 | Bacteria | 6264 |
| 7 | Ga0466703_003975 | 3300042636 | Bacteria | 1920 |
| 8 | Ga0466708_268231 | 3300042652 | Bacteria | 2340 |
| 9 | Ga0466727_313462 | 3300042655 | Bacteria | 28907 |
| 10 | Ga0466707_137613 | 3300042601 | Bacteria | 2387 |
| 11 | Ga0466722_020454 | 3300042609 | Bacteria | 15642 |
| 12 | IMNBL1DRAFT_c0002408 | 3300000062 | Bacteria | 13022 |
| 13 | JGI24696J40584_12790198 | 3300002834 | Bacteria | 851 |
| 14 | JGI24696J40584_12960737 | 3300002834 | Bacteria | 8269 |
| 15 | Ga0068305_10163583 | 3300005083 | Bacteria | 2071 |
| 16 | Ga0102735_1000227 | 3300007080 | Bacteria | 14283 |
| 17 | Ga0466696_068302 | 3300042596 | Bacteria | 6787 |
| 18 | Ga0466705_051098 | 3300042612 | Bacteria | 9320 |
| 19 | Ga0466710_410355 | 3300042613 | Bacteria | 2279 |
| 20 | Ga0466704_061950 | 3300042643 | Bacteria | 5620 |
| 21 | Ga0466713_133778 | 3300042602 | Bacteria | 3592 |
| 22 | Ga0466719_175174 | 3300042606 | Bacteria | 1282 |
| 23 | Ga0466722_132293 | 3300042609 | Bacteria | 4626 |
| 24 | Ga0466722_186879 | 3300042609 | Bacteria | 3223 |
| 25 | Ga0123357_10532767 | 3300009784 | Bacteria | 950 |
| 26 | Ga0123354_10060821 | 3300010882 | Bacteria | 5581 |
| 27 | 2227119704 | 2225789004 | Bacteria | 9202 |
| 28 | JGI24705J35276_12213265 | 3300002504 | Bacteria | 1918 |
| 29 | Ga0466656_083890 | 3300042550 | Bacteria | 3636 |
| 30 | Ga0466690_172045 | 3300042590 | Bacteria | 3146 |
| 31 | Ga0466696_231463 | 3300042596 | Bacteria | 10182 |
| 32 | Ga0466696_329102 | 3300042596 | Bacteria | 26774 |
| 33 | Ga0466699_278659 | 3300042597 | Bacteria | 1069 |
| 34 | Ga0466705_252899 | 3300042612 | Bacteria | 28436 |
| 35 | Ga0466711_173885 | 3300042615 | Bacteria | 5019 |
| 36 | Ga0466711_195793 | 3300042615 | Bacteria | 22291 |
| 37 | Ga0466729_283415 | 3300042621 | Bacteria | 1515 |
| 38 | Ga0466735_144649 | 3300042624 | Bacteria | 1613 |
| 39 | Ga0466703_038894 | 3300042636 | Bacteria | 5250 |
| 40 | Ga0466703_313801 | 3300042636 | Bacteria | 3436 |
| 41 | Ga0466727_174290 | 3300042655 | Unclassified | 4212 |
| 42 | Ga0466713_082373 | 3300042602 | Bacteria | 18425 |
| 43 | Ga0466713_151148 | 3300042602 | Bacteria | 25657 |
| 44 | Ga0466716_426363 | 3300042605 | Bacteria | 2374 |
| 45 | Ga0466722_153298 | 3300042609 | Bacteria | 32266 |
| 46 | Ga0466698_016608 | 3300042610 | Bacteria | 1105 |
| 47 | Ga0123355_10453304 | 3300009826 | Bacteria | 1615 |
| 48 | Ga0102734_1000097 | 3300007129 | Bacteria | 28598 |
| 49 | Ga0103267_1000494 | 3300007190 | Bacteria | 26232 |
| 50 | Ga0103268_1001640 | 3300007192 | Bacteria | 5404 |
| 51 | Ga0466696_259199 | 3300042596 | Bacteria | 9698 |
| 52 | Ga0466705_162749 | 3300042612 | Unclassified | 3332 |
| 53 | Ga0466715_209082 | 3300042616 | Bacteria | 53914 |
| 54 | Ga0466715_366527 | 3300042616 | Bacteria | 45823 |
| 55 | Ga0466723_095121 | 3300042618 | Bacteria | 177949 |
| 56 | Ga0466735_185957 | 3300042624 | Bacteria | 3626 |
| 57 | Ga0466704_378958 | 3300042643 | Bacteria | 17497 |
| 58 | Ga0466709_070059 | 3300042648 | Bacteria | 19387 |
| 59 | Ga0466709_150211 | 3300042648 | Bacteria | 3347 |
| 60 | Ga0466725_192694 | 3300042654 | Bacteria | 2865 |
| 61 | Ga0466727_183019 | 3300042655 | Bacteria | 5191 |
| 62 | Ga0466701_080303 | 3300042598 | Bacteria | 1341 |
| 63 | Ga0466706_104744 | 3300042599 | Bacteria | 41897 |
| 64 | Ga0466706_224119 | 3300042599 | Bacteria | 2919 |
| 65 | Ga0466707_021076 | 3300042601 | Bacteria | 7698 |
| 66 | Ga0466707_145086 | 3300042601 | Bacteria | 1177 |
| 67 | Ga0466719_057432 | 3300042606 | Bacteria | 11619 |
| 68 | Ga0466698_356627 | 3300042610 | Bacteria | 3011 |
| 69 | Ga0123357_10009396 | 3300009784 | Bacteria | 12348 |
| 70 | Ga0123354_10217608 | 3300010882 | Unclassified | 2041 |
| 71 | 2227247442 | 2225789004 | Bacteria | 32559 |
| 72 | IMNBL1DRAFT_c0000312 | 3300000062 | Bacteria | 41387 |
| 73 | IMNBL1DRAFT_c0000586 | 3300000062 | Bacteria | 29366 |
| 74 | JGI24702J35022_10006115 | 3300002462 | Bacteria | 6988 |
| 75 | JGI24702J35022_10112323 | 3300002462 | Bacteria | 1499 |
| 76 | JGI24705J35276_12146608 | 3300002504 | Bacteria | 1164 |
| 77 | JGI24696J40584_12959270 | 3300002834 | Bacteria | 4924 |
| 78 | Ga0072941_1366531 | 3300005201 | Bacteria | 1119 |
| 79 | Ga0466657_370862 | 3300042582 | Bacteria | 8014 |
| 80 | Ga0466690_323146 | 3300042590 | Bacteria | 40006 |
| 81 | Ga0466711_002120 | 3300042615 | Bacteria | 20160 |
| 82 | Ga0466715_135093 | 3300042616 | Bacteria | 13180 |
| 83 | Ga0466715_309137 | 3300042616 | Bacteria | 21840 |
| 84 | Ga0466723_068112 | 3300042618 | Bacteria | 13661 |
| 85 | Ga0466723_250705 | 3300042618 | Bacteria | 2486 |
| 86 | Ga0466726_213790 | 3300042619 | Bacteria | 2478 |
| 87 | Ga0466703_010278 | 3300042636 | Bacteria | 5517 |
| 88 | Ga0466708_209280 | 3300042652 | Bacteria | 27387 |
| 89 | Ga0466725_425080 | 3300042654 | Bacteria | 39967 |
| 90 | Ga0466707_243405 | 3300042601 | Bacteria | 10754 |
| 91 | Ga0466719_512777 | 3300042606 | Bacteria | 1432 |
| 92 | Ga0466722_083390 | 3300042609 | Bacteria | 1560 |
| 93 | Ga0466722_160732 | 3300042609 | Bacteria | 4921 |
| 94 | Ga0466697_047935 | 3300042611 | Bacteria | 2393 |
| 95 | Ga0123357_10025230 | 3300009784 | Bacteria | 8014 |
| 96 | Ga0123353_10649842 | 3300010167 | Bacteria | 1493 |
| 97 | IMNBGM34_c000958 | 3300000036 | Bacteria | 6148 |
| 98 | IMNBL1DRAFT_c0000452 | 3300000062 | Bacteria | 34320 |
| 99 | JGI24699J35502_11133898 | 3300002509 | Bacteria | 18539 |
| 100 | Ga0466690_408627 | 3300042590 | Bacteria | 146519 |
| 101 | Ga0466728_373515 | 3300042620 | Bacteria | 4302 |
| 102 | Ga0466735_081639 | 3300042624 | Bacteria | 9659 |
| 103 | Ga0466704_278805 | 3300042643 | Bacteria | 13521 |
| 104 | Ga0466713_031533 | 3300042602 | Bacteria | 55644 |
| 105 | Ga0466713_037442 | 3300042602 | Bacteria | 5908 |
| 106 | Ga0466713_127552 | 3300042602 | Bacteria | 9279 |
| 107 | Ga0466714_028916 | 3300042603 | Bacteria | 17372 |
| 108 | Ga0466714_075893 | 3300042603 | Bacteria | 13927 |
| 109 | Ga0466722_219492 | 3300042609 | Bacteria | 63959 |
| 110 | Ga0123356_10046677 | 3300010049 | Bacteria | 4030 |
| 111 | 2227328004 | 2225789004 | Bacteria | 6354 |
| 112 | JGI24702J35022_10023768 | 3300002462 | Bacteria | 3313 |
| 113 | JGI24699J35502_11134212 | 3300002509 | Bacteria | 62331 |
| 114 | Ga0072941_1102436 | 3300005201 | Bacteria | 2706 |
| 115 | Ga0466696_340727 | 3300042596 | Bacteria | 1656 |
| 116 | Ga0466705_113745 | 3300042612 | Bacteria | 1726 |
| 117 | Ga0466715_227332 | 3300042616 | Bacteria | 28106 |
| 118 | Ga0466729_218471 | 3300042621 | Bacteria | 3490 |
| 119 | Ga0466703_165375 | 3300042636 | Bacteria | 10827 |
| 120 | Ga0466704_309583 | 3300042643 | Bacteria | 5981 |
| 121 | Ga0466713_053809 | 3300042602 | Bacteria | 22044 |
| 122 | Ga0466717_096625 | 3300042604 | Bacteria | 2015 |
| 123 | Ga0466716_282690 | 3300042605 | Bacteria | 17125 |
| 124 | Ga0466719_159509 | 3300042606 | Bacteria | 3377 |
| 125 | Ga0466719_548336 | 3300042606 | Bacteria | 2914 |
| 126 | Ga0466722_132871 | 3300042609 | Bacteria | 7395 |
| 127 | Ga0123357_10022134 | 3300009784 | Bacteria | 8518 |
| 128 | Ga0123357_10097211 | 3300009784 | Bacteria | 3811 |
| 129 | Ga0123353_10000041 | 3300010167 | Bacteria | 137212 |
| 130 | JGI24702J35022_10002729 | 3300002462 | Bacteria | 10706 |
| 131 | JGI24702J35022_10006413 | 3300002462 | Bacteria | 6803 |
| 132 | JGI24702J35022_10073803 | 3300002462 | Bacteria | 1840 |
| 133 | JGI24702J35022_10276463 | 3300002462 | Bacteria | 984 |
| 134 | Ga0466690_000525 | 3300042590 | Bacteria | 32328 |
| 135 | Ga0466690_004498 | 3300042590 | Bacteria | 8412 |
| 136 | Ga0466690_065165 | 3300042590 | Bacteria | 5795 |
| 137 | Ga0466732_444082 | 3300042656 | Bacteria | 1107 |
| 138 | Ga0466723_043811 | 3300042618 | Bacteria | 26373 |
| 139 | Ga0466726_130685 | 3300042619 | Bacteria | 3454 |
| 140 | Ga0466729_064581 | 3300042621 | Bacteria | 4027 |
| 141 | Ga0466735_214194 | 3300042624 | Bacteria | 1380 |
| 142 | Ga0466703_176430 | 3300042636 | Bacteria | 35435 |
| 143 | Ga0466708_168531 | 3300042652 | Bacteria | 22724 |
| 144 | Ga0466727_092211 | 3300042655 | Bacteria | 1191 |
| 145 | Ga0466706_202937 | 3300042599 | Bacteria | 3626 |
| 146 | Ga0466700_156007 | 3300042600 | Bacteria | 3527 |
| 147 | Ga0466716_275839 | 3300042605 | Bacteria | 6200 |
| 148 | JGI24698J34947_10061174 | 3300002449 | Bacteria | 1854 |
| 149 | Ga0068305_10062174 | 3300005083 | Unclassified | 5399 |
| 150 | Ga0466692_117444 | 3300042591 | Bacteria | 15832 |
| 151 | Ga0466691_031773 | 3300042593 | Bacteria | 11494 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042604 | Ga0466717_096625 | Ga0466717_096625_726_1361 | 211 |
| 2 | 3300042602 | Ga0466713_151148 | Ga0466713_151148_23345_23989 | 214 |
| 3 | 3300042609 | Ga0466722_186879 | Ga0466722_186879_1723_2367 | 214 |
| 4 | 3300042621 | Ga0466729_283415 | Ga0466729_283415_60_704 | 214 |
| 5 | 3300042643 | Ga0466704_061950 | Ga0466704_061950_3684_4328 | 214 |
| 6 | iso_pr_bacteria | 2820759988 | 2820761153 | 214 |
| 7 | 3300002462 | JGI24702J35022_10002729 | JGI24702J35022_100027292 | 215 |
| 8 | 3300002509 | JGI24699J35502_11133898 | JGI24699J35502_1113389817 | 215 |
| 9 | 3300005083 | Ga0068305_10163583 | Ga0068305_101635832 | 215 |
| 10 | 3300042582 | Ga0466657_370862 | Ga0466657_370862_5556_6203 | 215 |
| 11 | 3300042598 | Ga0466701_080303 | Ga0466701_080303_543_1190 | 215 |
| 12 | 3300042606 | Ga0466719_512777 | Ga0466719_512777_447_1094 | 215 |
| 13 | 3300042609 | Ga0466722_219492 | Ga0466722_219492_60942_61589 | 215 |
| 14 | 3300042610 | Ga0466698_356627 | Ga0466698_356627_538_1185 | 215 |
| 15 | 3300042613 | Ga0466710_410355 | Ga0466710_410355_223_870 | 215 |
| 16 | 3300042620 | Ga0466728_460464 | Ga0466728_460464_1119_1766 | 215 |
| 17 | 3300042621 | Ga0466729_218471 | Ga0466729_218471_1001_1648 | 215 |
| 18 | 3300042654 | Ga0466725_192694 | Ga0466725_192694_1398_2045 | 215 |
| 19 | 2225789004 | 2227119704 | 2227512141 | 216 |
| 20 | 2225789004 | 2227328004 | 2227775659 | 216 |
| 21 | 3300002834 | JGI24696J40584_12959270 | JGI24696J40584_129592706 | 216 |
| 22 | 3300009784 | Ga0123357_10009396 | Ga0123357_100093968 | 216 |
| 23 | 3300009784 | Ga0123357_10022134 | Ga0123357_100221347 | 216 |
| 24 | 3300009784 | Ga0123357_10025230 | Ga0123357_100252305 | 216 |
| 25 | 3300009826 | Ga0123355_10453304 | Ga0123355_104533042 | 216 |
| 26 | 3300010882 | Ga0123354_10060821 | Ga0123354_100608215 | 216 |
| 27 | 3300042590 | Ga0466690_004498 | Ga0466690_004498_4938_5588 | 216 |
| 28 | 3300042590 | Ga0466690_065165 | Ga0466690_065165_1903_2553 | 216 |
| 29 | 3300042596 | Ga0466696_231463 | Ga0466696_231463_7847_8497 | 216 |
| 30 | 3300042597 | Ga0466699_278659 | Ga0466699_278659_72_722 | 216 |
| 31 | 3300042599 | Ga0466706_202937 | Ga0466706_202937_2000_2650 | 216 |
| 32 | 3300042600 | Ga0466700_156007 | Ga0466700_156007_1990_2640 | 216 |
| 33 | 3300042601 | Ga0466707_021076 | Ga0466707_021076_3617_4267 | 216 |
| 34 | 3300042601 | Ga0466707_137613 | Ga0466707_137613_690_1340 | 216 |
| 35 | 3300042602 | Ga0466713_031533 | Ga0466713_031533_28073_28723 | 216 |
| 36 | 3300042602 | Ga0466713_127552 | Ga0466713_127552_7007_7657 | 216 |
| 37 | 3300042603 | Ga0466714_075893 | Ga0466714_075893_4632_5282 | 216 |
| 38 | 3300042605 | Ga0466716_275839 | Ga0466716_275839_3133_3783 | 216 |
| 39 | 3300042605 | Ga0466716_426363 | Ga0466716_426363_1681_2331 | 216 |
| 40 | 3300042606 | Ga0466719_159509 | Ga0466719_159509_2110_2760 | 216 |
| 41 | 3300042606 | Ga0466719_175174 | Ga0466719_175174_357_1007 | 216 |
| 42 | 3300042609 | Ga0466722_083390 | Ga0466722_083390_54_704 | 216 |
| 43 | 3300042609 | Ga0466722_132293 | Ga0466722_132293_3020_3670 | 216 |
| 44 | 3300042609 | Ga0466722_153298 | Ga0466722_153298_14716_15366 | 216 |
| 45 | 3300042609 | Ga0466722_160732 | Ga0466722_160732_3180_3830 | 216 |
| 46 | 3300042611 | Ga0466697_047935 | Ga0466697_047935_372_1022 | 216 |
| 47 | 3300042612 | Ga0466705_051098 | Ga0466705_051098_3237_3887 | 216 |
| 48 | 3300042612 | Ga0466705_162749 | Ga0466705_162749_1490_2140 | 216 |
| 49 | 3300042615 | Ga0466711_002120 | Ga0466711_002120_11546_12196 | 216 |
| 50 | 3300042615 | Ga0466711_173885 | Ga0466711_173885_937_1587 | 216 |
| 51 | 3300042615 | Ga0466711_195793 | Ga0466711_195793_12433_13083 | 216 |
| 52 | 3300042616 | Ga0466715_227332 | Ga0466715_227332_2466_3116 | 216 |
| 53 | 3300042617 | Ga0466718_146506 | Ga0466718_146506_639_1289 | 216 |
| 54 | 3300042618 | Ga0466723_043811 | Ga0466723_043811_703_1353 | 216 |
| 55 | 3300042619 | Ga0466726_130685 | Ga0466726_130685_2248_2898 | 216 |
| 56 | 3300042619 | Ga0466726_213790 | Ga0466726_213790_626_1276 | 216 |
| 57 | 3300042620 | Ga0466728_373515 | Ga0466728_373515_1285_1935 | 216 |
| 58 | 3300042623 | Ga0466734_027745 | Ga0466734_027745_4595_5245 | 216 |
| 59 | 3300042624 | Ga0466735_214194 | Ga0466735_214194_371_1021 | 216 |
| 60 | 3300042636 | Ga0466703_313801 | Ga0466703_313801_336_986 | 216 |
| 61 | 3300042643 | Ga0466704_278805 | Ga0466704_278805_8103_8753 | 216 |
| 62 | 3300042648 | Ga0466709_070059 | Ga0466709_070059_18651_19301 | 216 |
| 63 | 3300042652 | Ga0466708_168531 | Ga0466708_168531_10934_11584 | 216 |
| 64 | 3300042652 | Ga0466708_209280 | Ga0466708_209280_11015_11665 | 216 |
| 65 | 3300042652 | Ga0466708_268231 | Ga0466708_268231_117_767 | 216 |
| 66 | 3300042654 | Ga0466725_425080 | Ga0466725_425080_18168_18818 | 216 |
| 67 | 3300042655 | Ga0466727_092211 | Ga0466727_092211_522_1172 | 216 |
| 68 | 3300042655 | Ga0466727_174290 | Ga0466727_174290_808_1458 | 216 |
| 69 | 3300042655 | Ga0466727_183019 | Ga0466727_183019_3506_4156 | 216 |
| 70 | 3300042655 | Ga0466727_313462 | Ga0466727_313462_2246_2896 | 216 |
| 71 | 3300042656 | Ga0466732_444082 | Ga0466732_444082_146_796 | 216 |
| 72 | 2225789004 | 2227247442 | 2227688711 | 217 |
| 73 | 3300000036 | IMNBGM34_c000958 | IMNBGM34_0009586 | 217 |
| 74 | 3300000062 | IMNBL1DRAFT_c0000452 | IMNBL1DRAFT_00004525 | 217 |
| 75 | 3300000062 | IMNBL1DRAFT_c0002408 | IMNBL1DRAFT_00024086 | 217 |
| 76 | 3300002462 | JGI24702J35022_10276463 | JGI24702J35022_102764632 | 217 |
| 77 | 3300002504 | JGI24705J35276_12146608 | JGI24705J35276_121466081 | 217 |
| 78 | 3300002504 | JGI24705J35276_12213265 | JGI24705J35276_122132652 | 217 |
| 79 | 3300002509 | JGI24699J35502_11134212 | JGI24699J35502_1113421219 | 217 |
| 80 | 3300002834 | JGI24696J40584_12790198 | JGI24696J40584_127901981 | 217 |
| 81 | 3300005083 | Ga0068305_10062174 | Ga0068305_100621743 | 217 |
| 82 | 3300005201 | Ga0072941_1102436 | Ga0072941_11024363 | 217 |
| 83 | 3300010049 | Ga0123356_10046677 | Ga0123356_100466777 | 217 |
| 84 | 3300010167 | Ga0123353_10000041 | Ga0123353_1000004138 | 217 |
| 85 | 3300042550 | Ga0466656_083890 | Ga0466656_083890_1343_1996 | 217 |
| 86 | 3300042590 | Ga0466690_000525 | Ga0466690_000525_9417_10070 | 217 |
| 87 | 3300042593 | Ga0466691_031773 | Ga0466691_031773_2102_2755 | 217 |
| 88 | 3300042599 | Ga0466706_224119 | Ga0466706_224119_71_724 | 217 |
| 89 | 3300042602 | Ga0466713_082373 | Ga0466713_082373_7878_8531 | 217 |
| 90 | 3300042605 | Ga0466716_282690 | Ga0466716_282690_11031_11684 | 217 |
| 91 | 3300042606 | Ga0466719_057432 | Ga0466719_057432_5083_5736 | 217 |
| 92 | 3300042610 | Ga0466698_016608 | Ga0466698_016608_270_923 | 217 |
| 93 | 3300042615 | Ga0466711_152157 | Ga0466711_152157_43443_44096 | 217 |
| 94 | 3300042616 | Ga0466715_366527 | Ga0466715_366527_8429_9082 | 217 |
| 95 | 3300042618 | Ga0466723_068112 | Ga0466723_068112_5917_6570 | 217 |
| 96 | 3300042621 | Ga0466729_064581 | Ga0466729_064581_3054_3707 | 217 |
| 97 | 3300042624 | Ga0466735_081639 | Ga0466735_081639_1169_1822 | 217 |
| 98 | 3300042624 | Ga0466735_185957 | Ga0466735_185957_707_1360 | 217 |
| 99 | 3300042636 | Ga0466703_003975 | Ga0466703_003975_775_1428 | 217 |
| 100 | 3300042636 | Ga0466703_038894 | Ga0466703_038894_773_1426 | 217 |
| 101 | 3300042636 | Ga0466703_176430 | Ga0466703_176430_6628_7281 | 217 |
| 102 | iso_pr_bacteria | 2820765201 | 2820766035 | 217 |
| 103 | 3300000062 | IMNBL1DRAFT_c0000586 | IMNBL1DRAFT_000058614 | 218 |
| 104 | 3300002462 | JGI24702J35022_10073803 | JGI24702J35022_100738031 | 218 |
| 105 | 3300002834 | JGI24696J40584_12960737 | JGI24696J40584_129607373 | 218 |
| 106 | 3300009784 | Ga0123357_10532767 | Ga0123357_105327671 | 218 |
| 107 | 3300042590 | Ga0466690_172045 | Ga0466690_172045_561_1217 | 218 |
| 108 | 3300042590 | Ga0466690_408627 | Ga0466690_408627_85393_86049 | 218 |
| 109 | 3300042602 | Ga0466713_037442 | Ga0466713_037442_3266_3922 | 218 |
| 110 | 3300042602 | Ga0466713_133778 | Ga0466713_133778_370_1026 | 218 |
| 111 | 3300042612 | Ga0466705_113745 | Ga0466705_113745_812_1468 | 218 |
| 112 | iso_pr_bacteria | 2820762746 | 2820764597 | 218 |
| 113 | iso_pr_bacteria | 3001995955 | 3001996219 | 218 |
| 114 | 3300000062 | IMNBL1DRAFT_c0000312 | IMNBL1DRAFT_000031232 | 219 |
| 115 | 3300007080 | Ga0102735_1000227 | Ga0102735_10002274 | 219 |
| 116 | 3300007129 | Ga0102734_1000097 | Ga0102734_100009715 | 219 |
| 117 | 3300042590 | Ga0466690_323146 | Ga0466690_323146_32182_32841 | 219 |
| 118 | 3300042591 | Ga0466692_117444 | Ga0466692_117444_7938_8597 | 219 |
| 119 | 3300042596 | Ga0466696_068302 | Ga0466696_068302_1954_2613 | 219 |
| 120 | 3300042596 | Ga0466696_259199 | Ga0466696_259199_1749_2408 | 219 |
| 121 | 3300042596 | Ga0466696_329102 | Ga0466696_329102_6523_7182 | 219 |
| 122 | 3300042596 | Ga0466696_340727 | Ga0466696_340727_969_1628 | 219 |
| 123 | 3300042601 | Ga0466707_243405 | Ga0466707_243405_2229_2888 | 219 |
| 124 | 3300042602 | Ga0466713_053809 | Ga0466713_053809_2551_3210 | 219 |
| 125 | 3300042603 | Ga0466714_028916 | Ga0466714_028916_287_946 | 219 |
| 126 | 3300042606 | Ga0466719_548336 | Ga0466719_548336_2062_2721 | 219 |
| 127 | 3300042612 | Ga0466705_252899 | Ga0466705_252899_12198_12857 | 219 |
| 128 | 3300042614 | Ga0466712_260838 | Ga0466712_260838_187_846 | 219 |
| 129 | 3300042616 | Ga0466715_135093 | Ga0466715_135093_5727_6386 | 219 |
| 130 | 3300042616 | Ga0466715_209082 | Ga0466715_209082_1059_1718 | 219 |
| 131 | 3300042618 | Ga0466723_095121 | Ga0466723_095121_54430_55089 | 219 |
| 132 | 3300042624 | Ga0466735_144649 | Ga0466735_144649_805_1464 | 219 |
| 133 | 3300042643 | Ga0466704_378958 | Ga0466704_378958_15694_16353 | 219 |
| 134 | 3300042648 | Ga0466709_150211 | Ga0466709_150211_910_1569 | 219 |
| 135 | 3300002449 | JGI24698J34947_10061174 | JGI24698J34947_100611742 | 220 |
| 136 | 3300002462 | JGI24702J35022_10006115 | JGI24702J35022_100061155 | 220 |
| 137 | 3300002462 | JGI24702J35022_10006413 | JGI24702J35022_100064134 | 220 |
| 138 | 3300002462 | JGI24702J35022_10023768 | JGI24702J35022_100237685 | 220 |
| 139 | 3300005201 | Ga0072941_1366531 | Ga0072941_13665312 | 220 |
| 140 | 3300007190 | Ga0103267_1000494 | Ga0103267_100049422 | 220 |
| 141 | 3300007192 | Ga0103268_1001640 | Ga0103268_10016405 | 220 |
| 142 | iso_pr_bacteria | 2561511170 | 2562331637 | 220 |
| 143 | iso_pr_bacteria | 2820741847 | 2820741985 | 220 |
| 144 | iso_pr_bacteria | 646311912 | 646377515 | 220 |
| 145 | 3300002462 | JGI24702J35022_10112323 | JGI24702J35022_101123232 | 221 |
| 146 | 3300009784 | Ga0123357_10097211 | Ga0123357_100972112 | 221 |
| 147 | 3300010167 | Ga0123353_10649842 | Ga0123353_106498422 | 221 |
| 148 | 3300010882 | Ga0123354_10217608 | Ga0123354_102176082 | 221 |
| 149 | 3300042616 | Ga0466715_309137 | Ga0466715_309137_181_846 | 221 |
| 150 | 3300042643 | Ga0466704_309583 | Ga0466704_309583_5194_5859 | 221 |
| 151 | 3300042636 | Ga0466703_165375 | Ga0466703_165375_6455_7126 | 223 |
| 152 | 3300042601 | Ga0466707_145086 | Ga0466707_145086_268_942 | 224 |
| 153 | 3300042599 | Ga0466706_104744 | Ga0466706_104744_16342_17019 | 225 |
| 154 | 3300042636 | Ga0466703_010278 | Ga0466703_010278_1214_1903 | 229 |
| 155 | 3300042609 | Ga0466722_132871 | Ga0466722_132871_4519_5217 | 232 |
| 156 | 3300042609 | Ga0466722_020454 | Ga0466722_020454_3143_3847 | 234 |
| 157 | 3300042618 | Ga0466723_250705 | Ga0466723_250705_1323_2060 | 245 |
| 158 | 3300042620 | Ga0466728_255153 | Ga0466728_255153_4015_4818 | 267 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00834 | Ribul_P_3_epim | Ribulose-phosphate 3 epimerase family | 55 | 251 | 0.99 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.82 | 0.85 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.