Protein Family IF08425

Metagenome Isolate
264 Members
111 Samples
235 Scaffolds
207.31 Avg Length

🧬 Representative Sequence

ID
3300042620|Ga0466728_181251|Ga0466728_181251_14027_14704
Length
225 aa
Sequence
MVAVRPRSAGFKENRTVARNLDPKCRQCRREGEKLFLKGEKCFTDKCAIERRSYAPGQHGQKSGARLSDYGVHLRAKQKIRRVYGVLEGQFRRTFAEAERRKGQTGENLLQLLEARLDSVAYRMGFGASRTEARQVVRHNGVLVNGKRVNIPSYTVCPGDVVSLTDSARGHLRVKAALEAAESRGFPEWIAVDVKEGKGTFKAMPQRAELSPTLNEGLVIELYSK

📊 Sample Types

Isolate 11.0%
Metagenome 89.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 29.8%
Unclassified 26.9%
Kalotermitidae 13.5%
Formicidae 12.5%
Armadillidiidae 3.8%
Rhinotermitidae 2.9%
Culicidae 2.9%
Termopsidae 2.9%
Curculionidae 1.9%
Elmidae 1.0%
Hydrophilidae 1.0%
Hodotermitidae 1.0%

🌳 Taxonomy

Archaea 0
Bacteria 227
Eukaryota 0
Viruses 0
Unclassified 37

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2590828841 Oscillospiraceae bacterium Ne3 Isolate Termitidae
2 2820065746 Unclassified Proteobacteria Nt197P3bin56 Isolate Unclassified
3 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
4 2820242869 Unclassified Firmicutes Th196P3bin82 Isolate Unclassified
5 2820367663 Unclassified Firmicutes Nt197P3bin105 Isolate Unclassified
6 2864761044 Stenotrophomonas rhizophilia S00008 Isolate Elmidae
7 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
8 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
9 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
10 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
11 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
12 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
13 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
14 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
15 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
16 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
17 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
18 2820047982 Unclassified Proteobacteria Th196P3bin67 Isolate Unclassified
19 2820131053 Unclassified Proteobacteria Emb289P3bin8 Isolate Unclassified
20 2820170025 Unclassified Proteobacteria Co191P1bin43 Isolate Unclassified
21 2873562573 Thermomonas sp. HDW16 Isolate Hydrophilidae
22 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
23 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
24 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
25 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
26 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
27 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
28 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
29 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
30 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
31 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
32 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
33 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
34 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
35 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
36 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
37 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
38 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
39 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
40 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
41 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
42 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
43 2820168331 Unclassified Proteobacteria Co191P3bin57 Isolate Unclassified
44 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
45 2838140227 Dyella sp. OAE510 Isolate Unclassified
46 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
47 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
48 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
49 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
50 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
51 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
52 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
53 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
54 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
55 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
56 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
57 2648501628 Xanthomonas sp. Cag60 Isolate Unclassified
58 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
59 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
60 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
61 2820166269 Unclassified Proteobacteria Co191P4bin16 Isolate Unclassified
62 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
63 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
64 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
65 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
66 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
67 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
68 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
69 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
70 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
71 2820134530 Unclassified Proteobacteria Emb289P3bin65 Isolate Unclassified
72 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
73 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
74 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
75 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
76 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
77 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
78 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
79 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
80 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
81 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
82 2548876789 Xanthomonas sacchari NCPPB 4393 Isolate
83 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
84 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
85 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
86 2820062699 Unclassified Proteobacteria Nt197P4bin15 Isolate Unclassified
87 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
88 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
89 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
90 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
91 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
92 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
93 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
94 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
95 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
96 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
97 2820042117 Unclassified Proteobacteria Th196P4bin58 Isolate Unclassified
98 2820050117 Unclassified Proteobacteria Th196P3bin129 Isolate Unclassified
99 2820053807 Unclassified Proteobacteria Th196P3bin117 Isolate Unclassified
100 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
101 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
102 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
103 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
104 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
105 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
106 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
107 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
108 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
109 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
110 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
111 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_424237 3300042612 Bacteria 1625
2 Ga0466710_075507 3300042613 Bacteria 36861
3 Ga0466710_205004 3300042613 Bacteria 1295
4 Ga0466711_406135 3300042615 Bacteria 4899
5 Ga0466711_425235 3300042615 Bacteria 23654
6 Ga0466723_124011 3300042618 Bacteria 17539
7 Ga0466723_126870 3300042618 Bacteria 23222
8 Ga0466726_017072 3300042619 Bacteria 3043
9 Ga0466703_118467 3300042636 Bacteria 10986
10 Ga0466703_229272 3300042636 Bacteria 5877
11 Ga0466703_254472 3300042636 Bacteria 9059
12 Ga0466704_261747 3300042643 Bacteria 1268
13 Ga0466709_187716 3300042648 Unclassified 5180
14 Ga0466708_088956 3300042652 Bacteria 13799
15 Ga0466708_308504 3300042652 Bacteria 17035
16 Ga0123353_10112952 3300010167 Bacteria 4373
17 Ga0123353_10414851 3300010167 Bacteria 1998
18 Ga0466717_122732 3300042604 Bacteria 7513
19 Ga0466717_146973 3300042604 Unclassified 1486
20 Ga0466719_047699 3300042606 Bacteria 11168
21 Ga0466719_079825 3300042606 Bacteria 11953
22 Ga0466719_257292 3300042606 Bacteria 1411
23 Ga0466721_355107 3300042608 Bacteria 1198
24 Ga0466722_141657 3300042609 Bacteria 8529
25 Ga0466698_098263 3300042610 Bacteria 2603
26 Ga0160440_100241 3300012815 Bacteria 37696
27 Ga0160467_105288 3300012829 Unclassified 1657
28 Ga0466657_015831 3300042582 Bacteria 1731
29 Ga0466657_087579 3300042582 Bacteria 8880
30 Ga0466657_108328 3300042582 Bacteria 20292
31 Ga0466692_184437 3300042591 Bacteria 20938
32 JGI24702J35022_10000742 3300002462 Bacteria 20088
33 JGI24702J35022_10023543 3300002462 Bacteria 3329
34 JGI24702J35022_10031378 3300002462 Bacteria 2848
35 Ga0068305_11122645 3300005083 Bacteria 1003
36 Ga0072941_1094013 3300005201 Bacteria 9449
37 Ga0102740_1004012 3300007140 Bacteria 3005
38 Ga0466705_129008 3300042612 Bacteria 16819
39 Ga0466705_146331 3300042612 Bacteria 2057
40 Ga0466715_227324 3300042616 Bacteria 3888
41 Ga0466715_266137 3300042616 Bacteria 6088
42 Ga0466726_032824 3300042619 Bacteria 12093
43 Ga0466726_188842 3300042619 Bacteria 15083
44 Ga0466726_406694 3300042619 Bacteria 19448
45 Ga0466703_054390 3300042636 Bacteria 2587
46 Ga0466704_113734 3300042643 Bacteria 2591
47 Ga0466709_095292 3300042648 Bacteria 2816
48 Ga0466709_110263 3300042648 Bacteria 16303
49 Ga0466708_215602 3300042652 Bacteria 15739
50 Ga0466725_017039 3300042654 Bacteria 50096
51 Ga0466727_335351 3300042655 Bacteria 67580
52 Ga0123353_10086533 3300010167 Bacteria 5047
53 Ga0123354_10228630 3300010882 Bacteria 1952
54 Ga0466701_047855 3300042598 Bacteria 5972
55 Ga0466719_055618 3300042606 Bacteria 10384
56 Ga0466722_136888 3300042609 Bacteria 17058
57 Ga0466697_056039 3300042611 Bacteria 2886
58 Ga0160441_118042 3300012825 Unclassified 710
59 Ga0264413_155874 3300024493 Bacteria 2120
60 Ga0466690_406175 3300042590 Bacteria 69346
61 Ga0466696_014827 3300042596 Bacteria 4965
62 CVPL010W_10097410 3300002931 Unclassified 889
63 Ga0103265_1004938 3300007068 Unclassified 1869
64 Ga0103267_1004199 3300007190 Unclassified 3910
65 Ga0466710_336951 3300042613 Bacteria 1196
66 Ga0466711_145003 3300042615 Bacteria 32111
67 Ga0466711_384879 3300042615 Bacteria 8015
68 Ga0466726_214965 3300042619 Bacteria 31160
69 Ga0466731_102560 3300042622 Bacteria 1792
70 Ga0466734_015756 3300042623 Bacteria 28187
71 Ga0466735_213234 3300042624 Unclassified 2711
72 Ga0466708_096576 3300042652 Bacteria 7680
73 Ga0466708_117775 3300042652 Bacteria 15479
74 Ga0466725_461929 3300042654 Bacteria 22391
75 Ga0123355_10551839 3300009826 Bacteria 1393
76 Ga0123356_10058150 3300010049 Bacteria 3605
77 Ga0466701_076559 3300042598 Bacteria 1320
78 Ga0466713_091546 3300042602 Bacteria 18477
79 Ga0466713_109624 3300042602 Bacteria 13785
80 Ga0466717_249419 3300042604 Bacteria 1064
81 Ga0466716_353952 3300042605 Bacteria 6349
82 Ga0466719_157184 3300042606 Bacteria 16488
83 Ga0466692_005110 3300042591 Bacteria 6672
84 Ga0466691_209335 3300042593 Bacteria 25069
85 Ga0466694_021039 3300042594 Bacteria 1419
86 CVPL010W_10002681 3300002931 Bacteria 20768
87 Ga0072941_1201580 3300005201 Bacteria 6589
88 Ga0103263_100016 3300007042 Unclassified 51420
89 Ga0102736_1000002 3300007052 Bacteria 204958
90 Ga0102735_1000153 3300007080 Unclassified 18167
91 Ga0102734_1001013 3300007129 Bacteria 7337
92 Ga0102737_1000003 3300007142 Bacteria 215134
93 Ga0103268_1004266 3300007192 Unclassified 5676
94 Ga0466733_059229 3300042659 Bacteria 36946
95 Ga0466729_318575 3300042621 Bacteria 3288
96 Ga0466703_345055 3300042636 Bacteria 10006
97 Ga0466709_416371 3300042648 Bacteria 3642
98 Ga0466708_301694 3300042652 Bacteria 11918
99 Ga0466725_191900 3300042654 Bacteria 2261
100 Ga0466727_137609 3300042655 Bacteria 15927
101 Ga0466727_209810 3300042655 Bacteria 1059
102 Ga0123357_10176297 3300009784 Bacteria 2512
103 Ga0123356_10049356 3300010049 Unclassified 3917
104 Ga0123356_11126870 3300010049 Bacteria 952
105 Ga0123353_10056133 3300010167 Unclassified 6303
106 Ga0123353_10092277 3300010167 Bacteria 4878
107 Ga0123353_10545588 3300010167 Bacteria 1674
108 Ga0123354_10145810 3300010882 Unclassified 2898
109 Ga0466716_494356 3300042605 Bacteria 3044
110 Ga0160444_100406 3300012841 Bacteria 21816
111 Ga0160448_100163 3300012854 Bacteria 30313
112 Ga0466657_083553 3300042582 Unclassified 16962
113 Ga0466657_327781 3300042582 Bacteria 1979
114 Ga0466690_408805 3300042590 Unclassified 5520
115 Ga0466693_340311 3300042592 Bacteria 1917
116 Ga0072941_1077030 3300005201 Bacteria 8650
117 Ga0102739_1005814 3300007095 Unclassified 3645
118 Ga0102734_1000029 3300007129 Bacteria 68380
119 Ga0123357_10000005 3300009784 Bacteria 295874
120 Ga0123357_10001915 3300009784 Bacteria 22651
121 Ga0466705_144704 3300042612 Bacteria 26960
122 Ga0466712_182347 3300042614 Bacteria 11394
123 Ga0466711_109307 3300042615 Bacteria 29995
124 Ga0466715_140159 3300042616 Bacteria 9478
125 Ga0466718_040435 3300042617 Unclassified 2919
126 Ga0466723_044796 3300042618 Bacteria 3114
127 Ga0466726_137556 3300042619 Bacteria 24871
128 Ga0466734_014035 3300042623 Bacteria 2820
129 Ga0466734_076859 3300042623 Bacteria 25073
130 Ga0466709_418632 3300042648 Bacteria 47357
131 Ga0466708_032942 3300042652 Bacteria 36683
132 Ga0123356_10054828 3300010049 Unclassified 3712
133 Ga0123353_10426012 3300010167 Bacteria 1964
134 Ga0123354_10002575 3300010882 Bacteria 24153
135 Ga0123354_10037100 3300010882 Unclassified 7590
136 Ga0466722_196355 3300042609 Bacteria 12120
137 Ga0160446_108407 3300012835 Unclassified 1364
138 Ga0160430_100531 3300012852 Bacteria 20613
139 Ga0160457_1000003 3300012858 Bacteria 1020748
140 Ga0160457_1000027 3300012858 Bacteria 297202
141 Ga0466691_156291 3300042593 Bacteria 26465
142 JGI24702J35022_10059009 3300002462 Bacteria 2050
143 Ga0072940_1285930 3300005200 Bacteria 2663
144 Ga0103263_100611 3300007042 Unclassified 4866
145 Ga0103264_1030278 3300007188 Unclassified 3416
146 Ga0123357_10000387 3300009784 Bacteria 41806
147 Ga0466705_211599 3300042612 Bacteria 21797
148 Ga0466710_038761 3300042613 Bacteria 64329
149 Ga0466729_084932 3300042621 Bacteria 104590
150 Ga0466729_147343 3300042621 Unclassified 5823
151 Ga0466735_036021 3300042624 Unclassified 3046
152 Ga0466704_405583 3300042643 Bacteria 15459
153 Ga0466725_164280 3300042654 Bacteria 17642
154 Ga0466725_185939 3300042654 Bacteria 36509
155 Ga0123353_10081105 3300010167 Bacteria 5217
156 Ga0123354_10008853 3300010882 Bacteria 15351
157 Ga0466701_090267 3300042598 Bacteria 1675
158 Ga0466700_152425 3300042600 Bacteria 1352
159 Ga0466707_106169 3300042601 Bacteria 14657
160 Ga0466707_175120 3300042601 Bacteria 20435
161 Ga0466707_370380 3300042601 Unclassified 2929
162 Ga0466714_026747 3300042603 Bacteria 1102
163 Ga0466716_122748 3300042605 Unclassified 1541
164 Ga0466719_006300 3300042606 Bacteria 1950
165 Ga0466719_486350 3300042606 Bacteria 13185
166 Ga0160472_101326 3300012839 Bacteria 7578
167 Ga0160444_101224 3300012841 Bacteria 5531
168 Ga0160444_108443 3300012841 Unclassified 1296
169 Ga0466656_229157 3300042550 Bacteria 2440
170 Ga0466657_199190 3300042582 Bacteria 1994
171 Ga0466690_149138 3300042590 Bacteria 14715
172 Ga0466690_321140 3300042590 Bacteria 25918
173 Ga0466695_302721 3300042595 Bacteria 1621
174 SPBB_contig00432 2044078006 Unclassified 1635
175 JGI24702J35022_10108096 3300002462 Bacteria 1528
176 JGI24705J35276_12237086 3300002504 Unclassified 9762
177 JGI24696J40584_12725565 3300002834 Bacteria 764
178 Ga0105524_104439 3300007733 Bacteria 6920
179 Ga0466710_416897 3300042613 Bacteria 23309
180 Ga0466715_301330 3300042616 Unclassified 2381
181 Ga0466715_438666 3300042616 Bacteria 23685
182 Ga0466723_020620 3300042618 Bacteria 11703
183 Ga0466726_004930 3300042619 Bacteria 4794
184 Ga0466726_129712 3300042619 Bacteria 4300
185 Ga0466728_181251 3300042620 Bacteria 18833
186 Ga0466729_059828 3300042621 Bacteria 4892
187 Ga0466735_010940 3300042624 Bacteria 1746
188 Ga0466702_383710 3300042635 Bacteria 2647
189 Ga0466703_060848 3300042636 Bacteria 8939
190 Ga0466703_320420 3300042636 Bacteria 23900
191 Ga0466704_195288 3300042643 Bacteria 25757
192 Ga0466704_484758 3300042643 Bacteria 1854
193 Ga0123357_10181051 3300009784 Bacteria 2461
194 Ga0123356_10001847 3300010049 Unclassified 22947
195 Ga0466717_185559 3300042604 Unclassified 6720
196 Ga0466719_112619 3300042606 Bacteria 9806
197 Ga0466719_126414 3300042606 Bacteria 59815
198 Ga0466722_023964 3300042609 Bacteria 4449
199 Ga0160443_100762 3300012848 Bacteria 16635
200 Ga0466694_332318 3300042594 Bacteria 3624
201 DPOL_contig13718 2035918003 Unclassified 2366
202 JGI24695J34938_10001235 3300002450 Bacteria 22520
203 Ga0103260_1000020 3300007139 Bacteria 70191
204 Ga0466697_134872 3300042611 Bacteria 5929
205 Ga0466697_225963 3300042611 Bacteria 1159
206 Ga0466710_211598 3300042613 Bacteria 14971
207 Ga0466715_044730 3300042616 Bacteria 7240
208 Ga0466723_233813 3300042618 Bacteria 18111
209 Ga0466731_136842 3300042622 Bacteria 1915
210 Ga0466734_013970 3300042623 Bacteria 6316
211 Ga0466735_222479 3300042624 Unclassified 4117
212 Ga0466703_276609 3300042636 Bacteria 60964
213 Ga0466708_164450 3300042652 Bacteria 37163
214 Ga0123356_10080362 3300010049 Bacteria 3082
215 Ga0123356_10087799 3300010049 Bacteria 2955
216 Ga0123356_11158996 3300010049 Bacteria 940
217 Ga0123353_10115883 3300010167 Bacteria 4312
218 Ga0123353_10267324 3300010167 Bacteria 2637
219 Ga0123353_10843155 3300010167 Bacteria 1258
220 Ga0123353_11352561 3300010167 Bacteria 920
221 Ga0466701_025535 3300042598 Bacteria 249043
222 Ga0466706_230345 3300042599 Bacteria 3696
223 Ga0466707_000724 3300042601 Bacteria 26529
224 Ga0466713_010828 3300042602 Bacteria 3416
225 Ga0466722_221140 3300042609 Bacteria 3560
226 Ga0466656_308387 3300042550 Bacteria 1473
227 Ga0466657_315176 3300042582 Unclassified 4246
228 Ga0466657_328956 3300042582 Bacteria 1972
229 Ga0466690_206122 3300042590 Bacteria 1375
230 Ga0466692_128697 3300042591 Bacteria 29218
231 Ga0466696_042576 3300042596 Bacteria 13410
232 Ga0068305_10048834 3300005083 Bacteria 7524
233 Ga0068305_10277852 3300005083 Bacteria 15502
234 Ga0103265_1001450 3300007068 Unclassified 3845
235 Ga0103268_1000831 3300007192 Bacteria 8628

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042615 Ga0466711_384879 Ga0466711_384879_6831_7346 171
2 3300042619 Ga0466726_214965 Ga0466726_214965_17914_18432 172
3 3300042608 Ga0466721_355107 Ga0466721_355107_584_1114 176
4 3300002931 CVPL010W_10097410 CVPL010W_100974101 181
5 3300010167 Ga0123353_11352561 Ga0123353_113525611 189
6 3300042652 Ga0466708_164450 Ga0466708_164450_2152_2721 189
7 3300024493 Ga0264413_155874 Ga0264413_1558742 190
8 3300042622 Ga0466731_102560 Ga0466731_102560_181_753 190
9 iso_pr_bacteria 2820053807 2820055286 190
10 iso_pr_bacteria 2820134530 2820135912 190
11 iso_pr_bacteria 2820166269 2820167850 190
12 iso_pr_bacteria 2820168331 2820168793 190
13 iso_pr_bacteria 2820170025 2820170091 190
14 3300002450 JGI24695J34938_10001235 JGI24695J34938_1000123530 191
15 3300009826 Ga0123355_10551839 Ga0123355_105518392 191
16 3300010049 Ga0123356_10001847 Ga0123356_100018477 191
17 3300042598 Ga0466701_090267 Ga0466701_090267_208_783 191
18 3300042605 Ga0466716_122748 Ga0466716_122748_40_615 191
19 3300042619 Ga0466726_137556 Ga0466726_137556_14681_15262 193
20 3300012854 Ga0160448_100163 Ga0160448_10016314 194
21 3300042582 Ga0466657_087579 Ga0466657_087579_1297_1881 194
22 3300042582 Ga0466657_327781 Ga0466657_327781_549_1178 194
23 3300042599 Ga0466706_230345 Ga0466706_230345_2807_3442 196
24 3300042603 Ga0466714_026747 Ga0466714_026747_311_907 198
25 3300042622 Ga0466731_136842 Ga0466731_136842_132_728 198
26 3300002462 JGI24702J35022_10031378 JGI24702J35022_100313781 199
27 3300010049 Ga0123356_10049356 Ga0123356_100493563 199
28 3300010049 Ga0123356_11126870 Ga0123356_111268702 199
29 3300010167 Ga0123353_10081105 Ga0123353_100811058 199
30 3300042619 Ga0466726_406694 Ga0466726_406694_14613_15212 199
31 3300007733 Ga0105524_104439 Ga0105524_1044394 200
32 3300042606 Ga0466719_157184 Ga0466719_157184_5128_5757 200
33 3300007095 Ga0102739_1005814 Ga0102739_10058142 204
34 3300042609 Ga0466722_136888 Ga0466722_136888_12140_12769 204
35 3300042606 Ga0466719_126414 Ga0466719_126414_28660_29280 206
36 3300042615 Ga0466711_425235 Ga0466711_425235_10007_10627 206
37 3300042618 Ga0466723_044796 Ga0466723_044796_1660_2280 206
38 3300042618 Ga0466723_126870 Ga0466723_126870_3023_3643 206
39 3300042636 Ga0466703_118467 Ga0466703_118467_5740_6360 206
40 3300010049 Ga0123356_10058150 Ga0123356_100581504 207
41 3300010049 Ga0123356_11158996 Ga0123356_111589962 207
42 3300042648 Ga0466709_418632 Ga0466709_418632_26075_26698 207
43 3300002834 JGI24696J40584_12725565 JGI24696J40584_127255651 208
44 3300042582 Ga0466657_199190 Ga0466657_199190_377_1003 208
45 3300042592 Ga0466693_340311 Ga0466693_340311_707_1333 208
46 3300042594 Ga0466694_021039 Ga0466694_021039_75_701 208
47 3300042594 Ga0466694_332318 Ga0466694_332318_1441_2067 208
48 3300042596 Ga0466696_014827 Ga0466696_014827_465_1091 208
49 3300042602 Ga0466713_010828 Ga0466713_010828_2701_3327 208
50 3300042610 Ga0466698_098263 Ga0466698_098263_158_784 208
51 3300042611 Ga0466697_134872 Ga0466697_134872_1857_2483 208
52 3300042611 Ga0466697_225963 Ga0466697_225963_251_877 208
53 3300042612 Ga0466705_144704 Ga0466705_144704_12307_12933 208
54 3300042612 Ga0466705_211599 Ga0466705_211599_2010_2636 208
55 3300042613 Ga0466710_205004 Ga0466710_205004_182_808 208
56 3300042619 Ga0466726_129712 Ga0466726_129712_2955_3581 208
57 3300042623 Ga0466734_076859 Ga0466734_076859_11996_12622 208
58 3300042636 Ga0466703_254472 Ga0466703_254472_7756_8382 208
59 3300042636 Ga0466703_345055 Ga0466703_345055_8059_8685 208
60 iso_pr_bacteria 2590828841 2593261642 208
61 iso_pr_bacteria 2820223845 2820225193 208
62 iso_pr_bacteria 2820250282 2820250600 208
63 iso_pr_bacteria 2820267566 2820267992 208
64 iso_pr_bacteria 2820367663 2820368544 208
65 iso_pr_bacteria 2838140227 2838144187 208
66 2035918003 DPOL_contig13718 DPOLB_2287430 209
67 2044078006 SPBB_contig00432 SPBB_204620 209
68 3300002462 JGI24702J35022_10000742 JGI24702J35022_1000074230 209
69 3300002462 JGI24702J35022_10108096 JGI24702J35022_101080962 209
70 3300005083 Ga0068305_10048834 Ga0068305_100488342 209
71 3300005083 Ga0068305_11122645 Ga0068305_111226452 209
72 3300007129 Ga0102734_1000029 Ga0102734_100002944 209
73 3300009784 Ga0123357_10176297 Ga0123357_101762972 209
74 3300009784 Ga0123357_10181051 Ga0123357_101810513 209
75 3300010049 Ga0123356_10087799 Ga0123356_100877992 209
76 3300010167 Ga0123353_10086533 Ga0123353_100865338 209
77 3300010167 Ga0123353_10092277 Ga0123353_100922772 209
78 3300010167 Ga0123353_10112952 Ga0123353_101129522 209
79 3300010167 Ga0123353_10115883 Ga0123353_101158834 209
80 3300010167 Ga0123353_10267324 Ga0123353_102673244 209
81 3300010167 Ga0123353_10426012 Ga0123353_104260122 209
82 3300010167 Ga0123353_10545588 Ga0123353_105455882 209
83 3300010167 Ga0123353_10843155 Ga0123353_108431551 209
84 3300010882 Ga0123354_10008853 Ga0123354_100088536 209
85 3300010882 Ga0123354_10228630 Ga0123354_102286302 209
86 3300042550 Ga0466656_229157 Ga0466656_229157_1311_1940 209
87 3300042582 Ga0466657_015831 Ga0466657_015831_35_664 209
88 3300042582 Ga0466657_083553 Ga0466657_083553_10889_11518 209
89 3300042582 Ga0466657_108328 Ga0466657_108328_35_664 209
90 3300042582 Ga0466657_315176 Ga0466657_315176_508_1137 209
91 3300042582 Ga0466657_328956 Ga0466657_328956_804_1433 209
92 3300042590 Ga0466690_149138 Ga0466690_149138_1742_2371 209
93 3300042590 Ga0466690_206122 Ga0466690_206122_14_643 209
94 3300042590 Ga0466690_321140 Ga0466690_321140_17990_18619 209
95 3300042590 Ga0466690_406175 Ga0466690_406175_51871_52500 209
96 3300042590 Ga0466690_408805 Ga0466690_408805_1974_2603 209
97 3300042591 Ga0466692_005110 Ga0466692_005110_1341_1970 209
98 3300042591 Ga0466692_128697 Ga0466692_128697_23839_24468 209
99 3300042593 Ga0466691_156291 Ga0466691_156291_18659_19288 209
100 3300042593 Ga0466691_209335 Ga0466691_209335_13136_13765 209
101 3300042595 Ga0466695_302721 Ga0466695_302721_580_1209 209
102 3300042596 Ga0466696_042576 Ga0466696_042576_1178_1807 209
103 3300042598 Ga0466701_025535 Ga0466701_025535_12506_13135 209
104 3300042598 Ga0466701_047855 Ga0466701_047855_3160_3789 209
105 3300042601 Ga0466707_000724 Ga0466707_000724_1307_1936 209
106 3300042601 Ga0466707_106169 Ga0466707_106169_4196_4825 209
107 3300042601 Ga0466707_175120 Ga0466707_175120_14032_14661 209
108 3300042601 Ga0466707_370380 Ga0466707_370380_2133_2762 209
109 3300042602 Ga0466713_091546 Ga0466713_091546_13413_14042 209
110 3300042602 Ga0466713_109624 Ga0466713_109624_6734_7363 209
111 3300042604 Ga0466717_122732 Ga0466717_122732_3227_3856 209
112 3300042604 Ga0466717_146973 Ga0466717_146973_781_1410 209
113 3300042604 Ga0466717_185559 Ga0466717_185559_1386_2015 209
114 3300042604 Ga0466717_249419 Ga0466717_249419_116_745 209
115 3300042605 Ga0466716_353952 Ga0466716_353952_4671_5300 209
116 3300042605 Ga0466716_494356 Ga0466716_494356_67_696 209
117 3300042606 Ga0466719_006300 Ga0466719_006300_965_1594 209
118 3300042606 Ga0466719_047699 Ga0466719_047699_1948_2577 209
119 3300042606 Ga0466719_055618 Ga0466719_055618_7104_7733 209
120 3300042606 Ga0466719_079825 Ga0466719_079825_8083_8712 209
121 3300042606 Ga0466719_112619 Ga0466719_112619_6748_7377 209
122 3300042606 Ga0466719_257292 Ga0466719_257292_596_1225 209
123 3300042606 Ga0466719_486350 Ga0466719_486350_12005_12634 209
124 3300042609 Ga0466722_023964 Ga0466722_023964_2210_2839 209
125 3300042609 Ga0466722_141657 Ga0466722_141657_1184_1813 209
126 3300042609 Ga0466722_196355 Ga0466722_196355_1219_1848 209
127 3300042609 Ga0466722_221140 Ga0466722_221140_2663_3292 209
128 3300042611 Ga0466697_056039 Ga0466697_056039_718_1347 209
129 3300042612 Ga0466705_129008 Ga0466705_129008_4087_4716 209
130 3300042612 Ga0466705_146331 Ga0466705_146331_433_1062 209
131 3300042612 Ga0466705_424237 Ga0466705_424237_791_1420 209
132 3300042613 Ga0466710_038761 Ga0466710_038761_795_1424 209
133 3300042613 Ga0466710_075507 Ga0466710_075507_6335_6964 209
134 3300042613 Ga0466710_211598 Ga0466710_211598_12276_12905 209
135 3300042615 Ga0466711_109307 Ga0466711_109307_12164_12793 209
136 3300042615 Ga0466711_145003 Ga0466711_145003_21670_22299 209
137 3300042615 Ga0466711_406135 Ga0466711_406135_1269_1898 209
138 3300042616 Ga0466715_044730 Ga0466715_044730_3445_4074 209
139 3300042616 Ga0466715_140159 Ga0466715_140159_5072_5701 209
140 3300042616 Ga0466715_227324 Ga0466715_227324_97_726 209
141 3300042616 Ga0466715_266137 Ga0466715_266137_2398_3027 209
142 3300042616 Ga0466715_301330 Ga0466715_301330_1575_2204 209
143 3300042616 Ga0466715_438666 Ga0466715_438666_7152_7781 209
144 3300042617 Ga0466718_040435 Ga0466718_040435_1765_2394 209
145 3300042618 Ga0466723_020620 Ga0466723_020620_8757_9386 209
146 3300042618 Ga0466723_124011 Ga0466723_124011_4322_4951 209
147 3300042618 Ga0466723_233813 Ga0466723_233813_8888_9517 209
148 3300042619 Ga0466726_004930 Ga0466726_004930_2026_2655 209
149 3300042619 Ga0466726_017072 Ga0466726_017072_1359_1988 209
150 3300042619 Ga0466726_032824 Ga0466726_032824_2235_2864 209
151 3300042619 Ga0466726_188842 Ga0466726_188842_2243_2872 209
152 3300042621 Ga0466729_059828 Ga0466729_059828_1029_1658 209
153 3300042621 Ga0466729_084932 Ga0466729_084932_92851_93480 209
154 3300042621 Ga0466729_147343 Ga0466729_147343_4936_5565 209
155 3300042621 Ga0466729_318575 Ga0466729_318575_608_1237 209
156 3300042623 Ga0466734_013970 Ga0466734_013970_3824_4453 209
157 3300042623 Ga0466734_014035 Ga0466734_014035_47_676 209
158 3300042623 Ga0466734_015756 Ga0466734_015756_12386_13015 209
159 3300042624 Ga0466735_010940 Ga0466735_010940_451_1080 209
160 3300042624 Ga0466735_036021 Ga0466735_036021_1672_2301 209
161 3300042624 Ga0466735_213234 Ga0466735_213234_710_1339 209
162 3300042624 Ga0466735_222479 Ga0466735_222479_1909_2538 209
163 3300042635 Ga0466702_383710 Ga0466702_383710_1966_2595 209
164 3300042636 Ga0466703_054390 Ga0466703_054390_583_1212 209
165 3300042636 Ga0466703_060848 Ga0466703_060848_1953_2582 209
166 3300042636 Ga0466703_229272 Ga0466703_229272_3951_4580 209
167 3300042636 Ga0466703_276609 Ga0466703_276609_22437_23066 209
168 3300042643 Ga0466704_113734 Ga0466704_113734_885_1514 209
169 3300042643 Ga0466704_195288 Ga0466704_195288_14503_15132 209
170 3300042643 Ga0466704_261747 Ga0466704_261747_548_1177 209
171 3300042643 Ga0466704_405583 Ga0466704_405583_2544_3173 209
172 3300042643 Ga0466704_484758 Ga0466704_484758_433_1062 209
173 3300042648 Ga0466709_095292 Ga0466709_095292_1077_1706 209
174 3300042648 Ga0466709_110263 Ga0466709_110263_1796_2425 209
175 3300042648 Ga0466709_187716 Ga0466709_187716_1736_2365 209
176 3300042648 Ga0466709_416371 Ga0466709_416371_388_1017 209
177 3300042652 Ga0466708_032942 Ga0466708_032942_24479_25108 209
178 3300042652 Ga0466708_088956 Ga0466708_088956_12117_12746 209
179 3300042652 Ga0466708_096576 Ga0466708_096576_2790_3419 209
180 3300042652 Ga0466708_117775 Ga0466708_117775_12677_13306 209
181 3300042652 Ga0466708_215602 Ga0466708_215602_2354_2983 209
182 3300042652 Ga0466708_301694 Ga0466708_301694_8218_8847 209
183 3300042652 Ga0466708_308504 Ga0466708_308504_2770_3399 209
184 3300042654 Ga0466725_164280 Ga0466725_164280_11517_12146 209
185 3300042654 Ga0466725_185939 Ga0466725_185939_23629_24258 209
186 3300042654 Ga0466725_461929 Ga0466725_461929_12051_12680 209
187 3300042655 Ga0466727_137609 Ga0466727_137609_13207_13836 209
188 3300042655 Ga0466727_209810 Ga0466727_209810_299_928 209
189 3300042655 Ga0466727_335351 Ga0466727_335351_25390_26019 209
190 3300042659 Ga0466733_059229 Ga0466733_059229_13643_14272 209
191 iso_pr_bacteria 2548876789 2549846461 209
192 iso_pr_bacteria 2648501628 2650561273 209
193 iso_pr_bacteria 2820042117 2820044711 209
194 iso_pr_bacteria 2820047982 2820048099 209
195 iso_pr_bacteria 2820050117 2820051538 209
196 iso_pr_bacteria 2820062699 2820063825 209
197 iso_pr_bacteria 2820065746 2820066493 209
198 iso_pr_bacteria 2820084079 2820085478 209
199 iso_pr_bacteria 2820086750 2820088267 209
200 iso_pr_bacteria 2820089333 2820090602 209
201 iso_pr_bacteria 2820103659 2820105481 209
202 iso_pr_bacteria 2820121232 2820121892 209
203 iso_pr_bacteria 2820123897 2820124502 209
204 iso_pr_bacteria 2820131053 2820132212 209
205 iso_pr_bacteria 2864761044 2864762377 209
206 iso_pr_bacteria 2873562573 2873564844 209
207 iso_pr_bacteria 2891720358 2891723367 209
208 3300002462 JGI24702J35022_10023543 JGI24702J35022_100235432 210
209 3300002462 JGI24702J35022_10059009 JGI24702J35022_100590093 210
210 3300002504 JGI24705J35276_12237086 JGI24705J35276_122370864 210
211 3300002931 CVPL010W_10002681 CVPL010W_1000268132 210
212 3300005083 Ga0068305_10277852 Ga0068305_102778525 210
213 3300005201 Ga0072941_1077030 Ga0072941_107703011 210
214 3300005201 Ga0072941_1094013 Ga0072941_109401311 210
215 3300005201 Ga0072941_1201580 Ga0072941_12015803 210
216 3300007042 Ga0103263_100016 Ga0103263_10001649 210
217 3300007042 Ga0103263_100611 Ga0103263_1006114 210
218 3300007052 Ga0102736_1000002 Ga0102736_1000002175 210
219 3300007068 Ga0103265_1001450 Ga0103265_10014504 210
220 3300007068 Ga0103265_1004938 Ga0103265_10049381 210
221 3300007080 Ga0102735_1000153 Ga0102735_10001533 210
222 3300007129 Ga0102734_1001013 Ga0102734_100101310 210
223 3300007139 Ga0103260_1000020 Ga0103260_100002043 210
224 3300007140 Ga0102740_1004012 Ga0102740_10040123 210
225 3300007142 Ga0102737_1000003 Ga0102737_1000003184 210
226 3300007188 Ga0103264_1030278 Ga0103264_10302782 210
227 3300007190 Ga0103267_1004199 Ga0103267_10041994 210
228 3300007192 Ga0103268_1000831 Ga0103268_10008312 210
229 3300007192 Ga0103268_1004266 Ga0103268_10042668 210
230 3300009784 Ga0123357_10000005 Ga0123357_10000005282 210
231 3300009784 Ga0123357_10000387 Ga0123357_1000038741 210
232 3300009784 Ga0123357_10001915 Ga0123357_1000191528 210
233 3300010049 Ga0123356_10054828 Ga0123356_100548284 210
234 3300010049 Ga0123356_10080362 Ga0123356_100803622 210
235 3300010167 Ga0123353_10056133 Ga0123353_100561331 210
236 3300010882 Ga0123354_10002575 Ga0123354_1000257528 210
237 3300010882 Ga0123354_10037100 Ga0123354_1003710012 210
238 3300010882 Ga0123354_10145810 Ga0123354_101458106 210
239 3300012815 Ga0160440_100241 Ga0160440_10024112 210
240 3300012825 Ga0160441_118042 Ga0160441_1180421 210
241 3300012829 Ga0160467_105288 Ga0160467_1052882 210
242 3300012835 Ga0160446_108407 Ga0160446_1084072 210
243 3300012839 Ga0160472_101326 Ga0160472_10132610 210
244 3300012841 Ga0160444_100406 Ga0160444_1004069 210
245 3300012841 Ga0160444_108443 Ga0160444_1084432 210
246 3300012848 Ga0160443_100762 Ga0160443_10076211 210
247 3300012852 Ga0160430_100531 Ga0160430_10053126 210
248 3300012858 Ga0160457_1000003 Ga0160457_100000326 210
249 3300042550 Ga0466656_308387 Ga0466656_308387_310_942 210
250 iso_pr_bacteria 2820242869 2820242972 210
251 3300010167 Ga0123353_10414851 Ga0123353_104148511 211
252 3300042654 Ga0466725_017039 Ga0466725_017039_13282_13917 211
253 3300042654 Ga0466725_191900 Ga0466725_191900_1495_2130 211
254 3300012841 Ga0160444_101224 Ga0160444_1012245 212
255 3300012858 Ga0160457_1000027 Ga0160457_1000027246 212
256 3300042598 Ga0466701_076559 Ga0466701_076559_243_890 215
257 3300042613 Ga0466710_336951 Ga0466710_336951_431_1078 215
258 3300042614 Ga0466712_182347 Ga0466712_182347_2001_2657 218
259 3300042613 Ga0466710_416897 Ga0466710_416897_11683_12345 220
260 3300005200 Ga0072940_1285930 Ga0072940_12859304 221
261 3300042591 Ga0466692_184437 Ga0466692_184437_8896_9567 223
262 3300042620 Ga0466728_181251 Ga0466728_181251_14027_14704 225
263 3300042636 Ga0466703_320420 Ga0466703_320420_21246_21923 225
264 3300042600 Ga0466700_152425 Ga0466700_152425_423_1127 234

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01479 S4 S4 domain 116 162 0.99
PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain 19 114 0.97

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01479 GO:0003723 RNA binding MF
PF00163 GO:0019843 rRNA binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.