Protein Family IF08403
Metagenome
Isolate
127
Members
47
Samples
120
Scaffolds
103.43
Avg Length
Representative Sequence
- ID
- 3300042620|Ga0466728_106212|Ga0466728_106212_250_588
- Length
- 102 aa
- Sequence
- LYYFTKGIIVPVGIKGESRVLPKKEQKLQEPGDYKVILLNDNYTTREFVVEILKLVFHKDVHHKGRGVVGVYSWDIATTKAAQVHTIARQYEYPLRCVVEEV
Sample Types
Isolate
5.5%
Metagenome
94.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.7%
Kalotermitidae
26.1%
Unclassified
15.2%
Rhinotermitidae
6.5%
Termopsidae
6.5%
Taxonomy
Archaea
0
Bacteria
122
Eukaryota
0
Viruses
1
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 2 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 3 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 4 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 8 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 9 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 10 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 14 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 18 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 22 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 23 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 28 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 32 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 35 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 36 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 37 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 40 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 41 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 42 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 43 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 44 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 47 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_11617820 | 3300010049 | Bacteria | 802 |
| 2 | Ga0123356_13060408 | 3300010049 | Bacteria | 583 |
| 3 | Ga0123353_11166402 | 3300010167 | Unclassified | 1015 |
| 4 | Ga0466690_153679 | 3300042590 | Bacteria | 9159 |
| 5 | Ga0466705_212865 | 3300042612 | Bacteria | 3251 |
| 6 | Ga0466703_105707 | 3300042636 | Bacteria | 3034 |
| 7 | Ga0466704_025694 | 3300042643 | Bacteria | 11309 |
| 8 | Ga0466704_313669 | 3300042643 | Bacteria | 6648 |
| 9 | Ga0466709_046910 | 3300042648 | Bacteria | 8300 |
| 10 | Ga0466715_159992 | 3300042616 | Bacteria | 1173 |
| 11 | Ga0466715_628269 | 3300042616 | Bacteria | 1901 |
| 12 | JGI24698J34947_10008024 | 3300002449 | Bacteria | 5796 |
| 13 | Ga0072941_1502352 | 3300005201 | Bacteria | 1216 |
| 14 | Ga0123357_10075027 | 3300009784 | Bacteria | 4470 |
| 15 | Ga0123357_10396483 | 3300009784 | Bacteria | 1261 |
| 16 | Ga0123356_13402583 | 3300010049 | Bacteria | 552 |
| 17 | Ga0123353_10104289 | 3300010167 | Bacteria | 4570 |
| 18 | Ga0123353_10446906 | 3300010167 | Bacteria | 1905 |
| 19 | Ga0123353_11698186 | 3300010167 | Bacteria | 791 |
| 20 | Ga0123353_12788688 | 3300010167 | Bacteria | 573 |
| 21 | Ga0466695_303424 | 3300042595 | Bacteria | 3441 |
| 22 | Ga0466699_278927 | 3300042597 | Bacteria | 1045 |
| 23 | Ga0466699_322330 | 3300042597 | Bacteria | 1033 |
| 24 | Ga0466712_265670 | 3300042614 | Bacteria | 2085 |
| 25 | Ga0466728_106212 | 3300042620 | Bacteria | 1394 |
| 26 | JGI24702J35022_10010569 | 3300002462 | Bacteria | 5155 |
| 27 | JGI24705J35276_11903193 | 3300002504 | Bacteria | 753 |
| 28 | Ga0466732_116046 | 3300042656 | Bacteria | 4539 |
| 29 | Ga0123355_10160882 | 3300009826 | Bacteria | 3383 |
| 30 | Ga0123353_10346050 | 3300010167 | Bacteria | 2243 |
| 31 | Ga0123353_11227885 | 3300010167 | Bacteria | 981 |
| 32 | Ga0123353_11284925 | 3300010167 | Bacteria | 952 |
| 33 | Ga0466692_156960 | 3300042591 | Bacteria | 1471 |
| 34 | Ga0466691_209954 | 3300042593 | Bacteria | 5035 |
| 35 | Ga0466705_382772 | 3300042612 | Bacteria | 4332 |
| 36 | Ga0466735_027391 | 3300042624 | Bacteria | 1005 |
| 37 | Ga0466708_316113 | 3300042652 | Bacteria | 1285 |
| 38 | Ga0466715_192625 | 3300042616 | Bacteria | 4226 |
| 39 | Ga0466718_161649 | 3300042617 | Bacteria | 1971 |
| 40 | JGI24698J34947_10032143 | 3300002449 | Unclassified | 2756 |
| 41 | JGI24695J34938_10074908 | 3300002450 | Bacteria | 1407 |
| 42 | JGI24705J35276_11313473 | 3300002504 | Bacteria | 505 |
| 43 | JGI24705J35276_12186900 | 3300002504 | Bacteria | 1424 |
| 44 | Ga0123356_11495718 | 3300010049 | Bacteria | 833 |
| 45 | Ga0123353_11092935 | 3300010167 | Bacteria | 1060 |
| 46 | Ga0123353_11184683 | 3300010167 | Bacteria | 1004 |
| 47 | Ga0123354_10213787 | 3300010882 | Bacteria | 2073 |
| 48 | Ga0466694_038035 | 3300042594 | Bacteria | 1307 |
| 49 | Ga0466694_160972 | 3300042594 | Bacteria | 8179 |
| 50 | Ga0466699_130403 | 3300042597 | Bacteria | 1192 |
| 51 | Ga0466699_186571 | 3300042597 | Bacteria | 1090 |
| 52 | Ga0466699_349441 | 3300042597 | Bacteria | 1532 |
| 53 | Ga0466721_265258 | 3300042608 | Bacteria | 1012 |
| 54 | Ga0466731_425026 | 3300042622 | Bacteria | 1035 |
| 55 | Ga0466704_312200 | 3300042643 | Bacteria | 21732 |
| 56 | Ga0466705_475774 | 3300042612 | Bacteria | 2065 |
| 57 | Ga0466715_214076 | 3300042616 | Bacteria | 7674 |
| 58 | JGI24702J35022_10000569 | 3300002462 | Bacteria | 22397 |
| 59 | JGI24702J35022_10112722 | 3300002462 | Bacteria | 1496 |
| 60 | JGI24702J35022_10421264 | 3300002462 | Bacteria | 809 |
| 61 | Ga0123357_10378962 | 3300009784 | Bacteria | 1315 |
| 62 | Ga0123353_10525001 | 3300010167 | Bacteria | 1716 |
| 63 | Ga0123353_10735978 | 3300010167 | Bacteria | 1376 |
| 64 | Ga0415639_122998 | 3300038395 | Bacteria | 2306 |
| 65 | Ga0466705_220802 | 3300042612 | Bacteria | 4598 |
| 66 | Ga0466718_046383 | 3300042617 | Bacteria | 1804 |
| 67 | JGI24702J35022_10265245 | 3300002462 | Bacteria | 1003 |
| 68 | Ga0123357_10658947 | 3300009784 | Bacteria | 771 |
| 69 | Ga0123353_10075768 | 3300010167 | Bacteria | 5406 |
| 70 | Ga0123353_10271377 | 3300010167 | Bacteria | 2613 |
| 71 | Ga0123353_10868327 | 3300010167 | Bacteria | 1233 |
| 72 | Ga0123353_12878537 | 3300010167 | Bacteria | 561 |
| 73 | Ga0466690_191019 | 3300042590 | Bacteria | 1055 |
| 74 | Ga0466694_213462 | 3300042594 | Bacteria | 29362 |
| 75 | Ga0466722_218908 | 3300042609 | Bacteria | 6573 |
| 76 | Ga0466731_434656 | 3300042622 | Bacteria | 3099 |
| 77 | Ga0466718_017064 | 3300042617 | Unclassified | 1521 |
| 78 | Ga0466718_068918 | 3300042617 | Bacteria | 3229 |
| 79 | JGI24698J34947_10196528 | 3300002449 | Bacteria | 793 |
| 80 | JGI24695J34938_10120577 | 3300002450 | Bacteria | 1068 |
| 81 | Ga0123357_10004358 | 3300009784 | Bacteria | 16590 |
| 82 | Ga0123356_11275621 | 3300010049 | Bacteria | 899 |
| 83 | Ga0123353_10022145 | 3300010167 | Bacteria | 9566 |
| 84 | Ga0123353_10800244 | 3300010167 | Bacteria | 1302 |
| 85 | Ga0466719_283768 | 3300042606 | Bacteria | 1032 |
| 86 | Ga0466722_153640 | 3300042609 | Bacteria | 24564 |
| 87 | Ga0466712_204794 | 3300042614 | Bacteria | 12824 |
| 88 | Ga0466715_199753 | 3300042616 | Bacteria | 18168 |
| 89 | Ga0466723_080631 | 3300042618 | Bacteria | 17818 |
| 90 | Ga0466726_252208 | 3300042619 | Bacteria | 1114 |
| 91 | Ga0466726_338311 | 3300042619 | Bacteria | 2299 |
| 92 | JGI24698J34947_10118061 | 3300002449 | Viruses | 1157 |
| 93 | JGI24702J35022_10485023 | 3300002462 | Bacteria | 756 |
| 94 | JGI24696J40584_12923456 | 3300002834 | Bacteria | 1376 |
| 95 | Ga0072940_1497757 | 3300005200 | Bacteria | 1008 |
| 96 | Ga0123356_10529851 | 3300010049 | Bacteria | 1337 |
| 97 | Ga0123356_13426632 | 3300010049 | Bacteria | 550 |
| 98 | Ga0123353_10646277 | 3300010167 | Bacteria | 1499 |
| 99 | Ga0123353_10743893 | 3300010167 | Bacteria | 1366 |
| 100 | Ga0123353_11065421 | 3300010167 | Bacteria | 1078 |
| 101 | Ga0123353_12339628 | 3300010167 | Bacteria | 641 |
| 102 | Ga0123353_13000726 | 3300010167 | Bacteria | 547 |
| 103 | Ga0123354_10232547 | 3300010882 | Bacteria | 1922 |
| 104 | Ga0123354_10802952 | 3300010882 | Bacteria | 634 |
| 105 | Ga0415639_026867 | 3300038395 | Bacteria | 13778 |
| 106 | Ga0415639_058468 | 3300038395 | Bacteria | 9872 |
| 107 | Ga0466691_081900 | 3300042593 | Bacteria | 1892 |
| 108 | Ga0466699_014113 | 3300042597 | Bacteria | 3555 |
| 109 | Ga0466716_234066 | 3300042605 | Bacteria | 1644 |
| 110 | Ga0466716_286003 | 3300042605 | Bacteria | 3911 |
| 111 | Ga0466720_014763 | 3300042607 | Bacteria | 2283 |
| 112 | Ga0466729_317481 | 3300042621 | Bacteria | 1780 |
| 113 | Ga0466704_572406 | 3300042643 | Bacteria | 3840 |
| 114 | Ga0466709_138646 | 3300042648 | Bacteria | 2841 |
| 115 | Ga0466708_204085 | 3300042652 | Bacteria | 9616 |
| 116 | Ga0466727_062175 | 3300042655 | Bacteria | 2841 |
| 117 | Ga0466718_015520 | 3300042617 | Unclassified | 1439 |
| 118 | Ga0466728_342917 | 3300042620 | Bacteria | 1272 |
| 119 | JGI24695J34938_10349500 | 3300002450 | Bacteria | 649 |
| 120 | JGI24695J34938_10477275 | 3300002450 | Bacteria | 567 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042591 | Ga0466692_156960 | Ga0466692_156960_360_665 | 92 |
| 2 | 3300005200 | Ga0072940_1497757 | Ga0072940_14977571 | 96 |
| 3 | 3300042616 | Ga0466715_628269 | Ga0466715_628269_698_1039 | 96 |
| 4 | 3300042619 | Ga0466726_338311 | Ga0466726_338311_234_524 | 96 |
| 5 | 3300042605 | Ga0466716_234066 | Ga0466716_234066_41_337 | 98 |
| 6 | 3300042605 | Ga0466716_286003 | Ga0466716_286003_535_831 | 98 |
| 7 | 3300042621 | Ga0466729_317481 | Ga0466729_317481_573_869 | 98 |
| 8 | 3300042609 | Ga0466722_153640 | Ga0466722_153640_17765_18064 | 99 |
| 9 | 3300038395 | Ga0415639_026867 | Ga0415639_026867_3318_3620 | 100 |
| 10 | 3300042594 | Ga0466694_160972 | Ga0466694_160972_2262_2564 | 100 |
| 11 | 3300042608 | Ga0466721_265258 | Ga0466721_265258_463_765 | 100 |
| 12 | 3300042622 | Ga0466731_434656 | Ga0466731_434656_955_1257 | 100 |
| 13 | iso_pr_bacteria | 2781125697 | 2781443235 | 100 |
| 14 | 3300002462 | JGI24702J35022_10010569 | JGI24702J35022_100105695 | 101 |
| 15 | 3300042617 | Ga0466718_015520 | Ga0466718_015520_349_654 | 101 |
| 16 | 3300042617 | Ga0466718_017064 | Ga0466718_017064_138_443 | 101 |
| 17 | 3300042617 | Ga0466718_046383 | Ga0466718_046383_799_1104 | 101 |
| 18 | 3300042617 | Ga0466718_068918 | Ga0466718_068918_2522_2827 | 101 |
| 19 | 3300042617 | Ga0466718_161649 | Ga0466718_161649_673_978 | 101 |
| 20 | 3300042656 | Ga0466732_116046 | Ga0466732_116046_2110_2415 | 101 |
| 21 | 3300002834 | JGI24696J40584_12923456 | JGI24696J40584_129234562 | 102 |
| 22 | 3300009784 | Ga0123357_10396483 | Ga0123357_103964832 | 102 |
| 23 | 3300010167 | Ga0123353_10022145 | Ga0123353_100221455 | 102 |
| 24 | 3300010167 | Ga0123353_10735978 | Ga0123353_107359783 | 102 |
| 25 | 3300010167 | Ga0123353_12878537 | Ga0123353_128785371 | 102 |
| 26 | 3300042609 | Ga0466722_218908 | Ga0466722_218908_360_668 | 102 |
| 27 | 3300042616 | Ga0466715_199753 | Ga0466715_199753_7340_7648 | 102 |
| 28 | 3300042620 | Ga0466728_106212 | Ga0466728_106212_250_588 | 102 |
| 29 | 3300010167 | Ga0123353_10446906 | Ga0123353_104469062 | 103 |
| 30 | 3300010167 | Ga0123353_11227885 | Ga0123353_112278852 | 103 |
| 31 | 3300038395 | Ga0415639_058468 | Ga0415639_058468_912_1223 | 103 |
| 32 | 3300038395 | Ga0415639_122998 | Ga0415639_122998_443_754 | 103 |
| 33 | 3300042590 | Ga0466690_153679 | Ga0466690_153679_8680_8991 | 103 |
| 34 | 3300042590 | Ga0466690_191019 | Ga0466690_191019_154_465 | 103 |
| 35 | 3300042593 | Ga0466691_081900 | Ga0466691_081900_1447_1758 | 103 |
| 36 | 3300042593 | Ga0466691_209954 | Ga0466691_209954_1060_1371 | 103 |
| 37 | 3300042594 | Ga0466694_038035 | Ga0466694_038035_318_629 | 103 |
| 38 | 3300042594 | Ga0466694_213462 | Ga0466694_213462_6142_6453 | 103 |
| 39 | 3300042595 | Ga0466695_303424 | Ga0466695_303424_984_1295 | 103 |
| 40 | 3300042597 | Ga0466699_130403 | Ga0466699_130403_265_576 | 103 |
| 41 | 3300042597 | Ga0466699_278927 | Ga0466699_278927_100_411 | 103 |
| 42 | 3300042597 | Ga0466699_322330 | Ga0466699_322330_46_357 | 103 |
| 43 | 3300042606 | Ga0466719_283768 | Ga0466719_283768_51_362 | 103 |
| 44 | 3300042607 | Ga0466720_014763 | Ga0466720_014763_842_1153 | 103 |
| 45 | 3300042612 | Ga0466705_212865 | Ga0466705_212865_1802_2113 | 103 |
| 46 | 3300042612 | Ga0466705_220802 | Ga0466705_220802_3304_3615 | 103 |
| 47 | 3300042612 | Ga0466705_382772 | Ga0466705_382772_3494_3805 | 103 |
| 48 | 3300042612 | Ga0466705_475774 | Ga0466705_475774_1410_1721 | 103 |
| 49 | 3300042614 | Ga0466712_204794 | Ga0466712_204794_7437_7748 | 103 |
| 50 | 3300042614 | Ga0466712_265670 | Ga0466712_265670_852_1163 | 103 |
| 51 | 3300042616 | Ga0466715_159992 | Ga0466715_159992_199_510 | 103 |
| 52 | 3300042616 | Ga0466715_192625 | Ga0466715_192625_1861_2172 | 103 |
| 53 | 3300042616 | Ga0466715_214076 | Ga0466715_214076_5905_6216 | 103 |
| 54 | 3300042618 | Ga0466723_080631 | Ga0466723_080631_5568_5879 | 103 |
| 55 | 3300042619 | Ga0466726_252208 | Ga0466726_252208_77_388 | 103 |
| 56 | 3300042620 | Ga0466728_342917 | Ga0466728_342917_752_1063 | 103 |
| 57 | 3300042622 | Ga0466731_425026 | Ga0466731_425026_412_723 | 103 |
| 58 | 3300042624 | Ga0466735_027391 | Ga0466735_027391_257_568 | 103 |
| 59 | 3300042636 | Ga0466703_105707 | Ga0466703_105707_291_602 | 103 |
| 60 | 3300042643 | Ga0466704_025694 | Ga0466704_025694_7155_7466 | 103 |
| 61 | 3300042643 | Ga0466704_312200 | Ga0466704_312200_4762_5073 | 103 |
| 62 | 3300042643 | Ga0466704_313669 | Ga0466704_313669_1737_2048 | 103 |
| 63 | 3300042643 | Ga0466704_572406 | Ga0466704_572406_437_748 | 103 |
| 64 | 3300042648 | Ga0466709_046910 | Ga0466709_046910_4406_4717 | 103 |
| 65 | 3300042648 | Ga0466709_138646 | Ga0466709_138646_249_560 | 103 |
| 66 | 3300042652 | Ga0466708_204085 | Ga0466708_204085_7488_7799 | 103 |
| 67 | 3300042652 | Ga0466708_316113 | Ga0466708_316113_638_949 | 103 |
| 68 | 3300042655 | Ga0466727_062175 | Ga0466727_062175_1017_1328 | 103 |
| 69 | iso_pr_bacteria | 2781125632 | 2781270340 | 103 |
| 70 | iso_pr_bacteria | 2781125666 | 2781345505 | 103 |
| 71 | iso_pr_bacteria | 2781125681 | 2781407554 | 103 |
| 72 | iso_pr_bacteria | 2781125686 | 2781419176 | 103 |
| 73 | iso_pr_bacteria | 2781125694 | 2781435142 | 103 |
| 74 | 3300002449 | JGI24698J34947_10008024 | JGI24698J34947_100080242 | 104 |
| 75 | 3300002449 | JGI24698J34947_10032143 | JGI24698J34947_100321431 | 104 |
| 76 | 3300002449 | JGI24698J34947_10118061 | JGI24698J34947_101180612 | 104 |
| 77 | 3300002449 | JGI24698J34947_10196528 | JGI24698J34947_101965282 | 104 |
| 78 | 3300002450 | JGI24695J34938_10120577 | JGI24695J34938_101205772 | 104 |
| 79 | 3300002450 | JGI24695J34938_10349500 | JGI24695J34938_103495001 | 104 |
| 80 | 3300002450 | JGI24695J34938_10477275 | JGI24695J34938_104772751 | 104 |
| 81 | 3300002462 | JGI24702J35022_10000569 | JGI24702J35022_100005695 | 104 |
| 82 | 3300002462 | JGI24702J35022_10112722 | JGI24702J35022_101127222 | 104 |
| 83 | 3300002462 | JGI24702J35022_10265245 | JGI24702J35022_102652452 | 104 |
| 84 | 3300002462 | JGI24702J35022_10421264 | JGI24702J35022_104212642 | 104 |
| 85 | 3300002462 | JGI24702J35022_10485023 | JGI24702J35022_104850232 | 104 |
| 86 | 3300002504 | JGI24705J35276_11313473 | JGI24705J35276_113134731 | 104 |
| 87 | 3300002504 | JGI24705J35276_11903193 | JGI24705J35276_119031931 | 104 |
| 88 | 3300002504 | JGI24705J35276_12186900 | JGI24705J35276_121869002 | 104 |
| 89 | 3300005201 | Ga0072941_1502352 | Ga0072941_15023523 | 104 |
| 90 | 3300009784 | Ga0123357_10004358 | Ga0123357_100043581 | 104 |
| 91 | 3300009784 | Ga0123357_10075027 | Ga0123357_100750276 | 104 |
| 92 | 3300009784 | Ga0123357_10378962 | Ga0123357_103789621 | 104 |
| 93 | 3300009784 | Ga0123357_10658947 | Ga0123357_106589472 | 104 |
| 94 | 3300009826 | Ga0123355_10160882 | Ga0123355_101608822 | 104 |
| 95 | 3300010049 | Ga0123356_11275621 | Ga0123356_112756212 | 104 |
| 96 | 3300010049 | Ga0123356_11495718 | Ga0123356_114957182 | 104 |
| 97 | 3300010049 | Ga0123356_11617820 | Ga0123356_116178201 | 104 |
| 98 | 3300010049 | Ga0123356_13060408 | Ga0123356_130604081 | 104 |
| 99 | 3300010049 | Ga0123356_13402583 | Ga0123356_134025831 | 104 |
| 100 | 3300010049 | Ga0123356_13426632 | Ga0123356_134266321 | 104 |
| 101 | 3300010167 | Ga0123353_10075768 | Ga0123353_100757685 | 104 |
| 102 | 3300010167 | Ga0123353_10104289 | Ga0123353_101042892 | 104 |
| 103 | 3300010167 | Ga0123353_10271377 | Ga0123353_102713773 | 104 |
| 104 | 3300010167 | Ga0123353_10346050 | Ga0123353_103460502 | 104 |
| 105 | 3300010167 | Ga0123353_10525001 | Ga0123353_105250011 | 104 |
| 106 | 3300010167 | Ga0123353_10646277 | Ga0123353_106462772 | 104 |
| 107 | 3300010167 | Ga0123353_10743893 | Ga0123353_107438932 | 104 |
| 108 | 3300010167 | Ga0123353_10800244 | Ga0123353_108002442 | 104 |
| 109 | 3300010167 | Ga0123353_11065421 | Ga0123353_110654212 | 104 |
| 110 | 3300010167 | Ga0123353_11092935 | Ga0123353_110929352 | 104 |
| 111 | 3300010167 | Ga0123353_11184683 | Ga0123353_111846831 | 104 |
| 112 | 3300010167 | Ga0123353_11284925 | Ga0123353_112849252 | 104 |
| 113 | 3300010167 | Ga0123353_11698186 | Ga0123353_116981861 | 104 |
| 114 | 3300010167 | Ga0123353_12339628 | Ga0123353_123396281 | 104 |
| 115 | 3300010167 | Ga0123353_12788688 | Ga0123353_127886881 | 104 |
| 116 | 3300010167 | Ga0123353_13000726 | Ga0123353_130007261 | 104 |
| 117 | 3300010882 | Ga0123354_10213787 | Ga0123354_102137872 | 104 |
| 118 | 3300010882 | Ga0123354_10232547 | Ga0123354_102325471 | 104 |
| 119 | iso_pr_bacteria | 650716099 | 650879236 | 104 |
| 120 | 3300042597 | Ga0466699_014113 | Ga0466699_014113_463_789 | 108 |
| 121 | 3300042597 | Ga0466699_186571 | Ga0466699_186571_712_1038 | 108 |
| 122 | 3300042597 | Ga0466699_349441 | Ga0466699_349441_711_1037 | 108 |
| 123 | 3300010167 | Ga0123353_11166402 | Ga0123353_111664022 | 111 |
| 124 | 3300010882 | Ga0123354_10802952 | Ga0123354_108029521 | 111 |
| 125 | 3300010167 | Ga0123353_10868327 | Ga0123353_108683272 | 115 |
| 126 | 3300010049 | Ga0123356_10529851 | Ga0123356_105298512 | 120 |
| 127 | 3300002450 | JGI24695J34938_10074908 | JGI24695J34938_100749082 | 139 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02617 | ClpS | ATP-dependent Clp protease adaptor protein ClpS | 30 | 97 | 0.97 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02617 | GO:0030163 | protein catabolic process | BP |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.59 | 0.77 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.