Protein Family IF08396

Metagenome Isolate
154 Members
94 Samples
122 Scaffolds
250.62 Avg Length

🧬 Representative Sequence

ID
3300042620|Ga0466728_083471|Ga0466728_083471_55104_55982
Length
292 aa
Sequence
MFKKINKSLLFYVKIPIYLVYFLDFYLSLLRKGNRMFPWFSKKEKKIDSEVKFEPEGKIPKHIAIIMDGNGRWASKRKLPRIAGHKEGMEAVKKVTTAASKLGVKVLTLYAFSTENWKRPDKEVKFLMKLPIDFFDHFVPELVKENVQVKTMGYVENLPAHTQDAVINAIEKTKDNTGMILNFALNYGGRAELLTTFQLLAKEVKNENLSPLDVSEEKVNDALMTGFLEKEFRDPELLIRTSGEERISNFLLWQLAYSEFYFTEELWPDFDGKSLKYAIAIFQKRNRRFGGL

📊 Sample Types

Isolate 20.8%
Metagenome 79.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 24.7%
Termitidae 23.6%
Kalotermitidae 12.4%
Formicidae 12.4%
Tenebrionidae 4.5%
Rhinotermitidae 4.5%
Termopsidae 4.5%
Armadillidiidae 2.2%
Blattidae 2.2%
Passalidae 2.2%
Drosophilidae 2.2%
Apidae 2.2%
Bombycidae 1.1%
Hodotermitidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 147
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820854745 Unclassified Actinobacteria Lab288P3bin234 Isolate Unclassified
2 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
3 2820921285 Unclassified Actinobacteria Emb289P3bin53 Isolate Unclassified
4 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
5 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
6 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
7 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
8 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
15 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
16 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
17 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
18 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
19 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
20 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
21 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
22 2603880173 Pseudomonas SP. Isolate Unclassified
23 2687453755 Pseudomonadales bacterium Cag27 Isolate Unclassified
24 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
25 2820476618 Unclassified Firmicutes Lab288P1bin80 Isolate Unclassified
26 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
27 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
28 8007223943 Enterococcus sp. MSG2901 Isolate
29 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
30 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
31 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
32 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
33 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
34 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
35 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
36 2920168565 Paludibacter sp. 221 Isolate Blattidae
37 8114555646 Enterococcus sp. DIV1094 Isolate
38 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
39 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
40 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
41 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
42 2820856540 Unclassified Actinobacteria Lab288P3bin21 Isolate Unclassified
43 2687453756 Pseudomonadales bacterium Cag32 Isolate Unclassified
44 2820393573 Unclassified Firmicutes Nc150P1bin9 Isolate Unclassified
45 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
46 8108568626 Enterococcus sp. DIV1094 Isolate
47 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
48 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
49 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
50 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
51 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
52 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
53 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
54 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
55 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
56 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
57 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
58 2687453754 Pseudomonadales bacterium Cag26 Isolate Unclassified
59 2820010479 Unclassified Spirochaetes Th196P4bin55 Isolate Unclassified
60 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
61 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
62 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
63 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
64 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
65 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
66 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
67 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
68 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
69 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
70 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
71 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
72 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
73 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
74 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
75 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
76 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
77 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
78 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
79 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
80 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
81 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
82 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
83 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
84 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
85 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
86 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
87 2819998259 Unclassified Spirochaetes Nc150P4bin23 Isolate Unclassified
88 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
89 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
90 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
91 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
92 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
93 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
94 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_126925 3300042611 Bacteria 1336
2 Ga0562378_0030 3300056814 Bacteria 540869
3 Ga0160468_100098 3300012819 Bacteria 101080
4 Ga0466690_266154 3300042590 Bacteria 16703
5 Ga0466696_306630 3300042596 Bacteria 3241
6 Ga0466710_126556 3300042613 Bacteria 3726
7 Ga0466703_007779 3300042636 Bacteria 9718
8 Ga0466725_015802 3300042654 Bacteria 8731
9 Ga0466719_350716 3300042606 Bacteria 4488
10 Ga0466697_031221 3300042611 Bacteria 1614
11 Ga0123353_10067941 3300010167 Bacteria 5723
12 Ga0123353_10215113 3300010167 Bacteria 3011
13 2227577403 2225789004 Bacteria 13551
14 JGI24703J35330_11744667 3300002501 Bacteria 4262
15 JGI24703J35330_11748186 3300002501 Bacteria 11718
16 Ga0103264_1000462 3300007188 Bacteria 27826
17 Ga0103264_1000489 3300007188 Bacteria 22136
18 Ga0103268_1000002 3300007192 Bacteria 107289
19 Ga0562378_2199 3300056814 Unclassified 17208
20 Ga0466726_149647 3300042619 Bacteria 8960
21 Ga0466713_130567 3300042602 Bacteria 13992
22 Ga0123357_10085767 3300009784 Bacteria 4122
23 Ga0123355_10006233 3300009826 Bacteria 17621
24 Ga0123355_10021683 3300009826 Bacteria 10286
25 Ga0123353_10002414 3300010167 Bacteria 23221
26 Ga0123353_10011780 3300010167 Bacteria 12350
27 IMNBL1DRAFT_c0040190 3300000062 Bacteria 1586
28 JGI24702J35022_10004250 3300002462 Bacteria 8549
29 CVPL010W_10001425 3300002931 Bacteria 27970
30 Ga0103265_1000023 3300007068 Bacteria 32322
31 Ga0466733_217385 3300042659 Bacteria 25662
32 Ga0562379_0049 3300056790 Bacteria 522222
33 Ga0466715_464220 3300042616 Unclassified 4402
34 Ga0466735_233356 3300042624 Bacteria 2189
35 Ga0466724_06008 3300042649 Bacteria 1220
36 Ga0466725_142165 3300042654 Bacteria 12020
37 Ga0466727_034401 3300042655 Bacteria 27774
38 Ga0466719_466443 3300042606 Bacteria 8952
39 Ga0466698_479961 3300042610 Bacteria 1423
40 Ga0123355_10012631 3300009826 Bacteria 13092
41 Ga0123355_10371952 3300009826 Bacteria 1871
42 Ga0123353_10155822 3300010167 Bacteria 3641
43 JGI24702J35022_10005031 3300002462 Bacteria 7786
44 JGI24702J35022_10012338 3300002462 Unclassified 4753
45 JGI24702J35022_10126763 3300002462 Bacteria 1414
46 Ga0102739_1000071 3300007095 Bacteria 31158
47 Ga0103264_1017199 3300007188 Bacteria 3538
48 Ga0562379_0064 3300056790 Bacteria 452272
49 Ga0466696_246206 3300042596 Bacteria 12912
50 Ga0466726_234364 3300042619 Bacteria 32912
51 Ga0466734_137802 3300042623 Bacteria 22603
52 Ga0123355_10037586 3300009826 Bacteria 7873
53 JGI24695J34938_10000473 3300002450 Bacteria 38985
54 JGI24702J35022_10001795 3300002462 Bacteria 13233
55 CVPL005W_1000107 3300002934 Bacteria 34056
56 Ga0102739_1005126 3300007095 Bacteria 1811
57 Ga0562374_1398 3300057007 Bacteria 28476
58 Ga0466656_362369 3300042550 Bacteria 4034
59 Ga0466715_181761 3300042616 Bacteria 4137
60 Ga0466704_088677 3300042643 Bacteria 8921
61 Ga0466725_464824 3300042654 Bacteria 28639
62 Ga0466707_271840 3300042601 Bacteria 8118
63 Ga0466714_028666 3300042603 Bacteria 89946
64 Ga0123355_10008773 3300009826 Bacteria 15295
65 Ga0123355_10040422 3300009826 Bacteria 7590
66 Ga0123355_10202083 3300009826 Bacteria 2900
67 Ga0123353_10429471 3300010167 Bacteria 1954
68 2227133584 2225789004 Bacteria 8876
69 Ga0068302_10005196 3300005071 Bacteria 15357
70 Ga0562378_0212 3300056814 Bacteria 138560
71 Ga0255572_1002002 3300026175 Bacteria 18732
72 Ga0466693_176964 3300042592 Bacteria 2811
73 Ga0466696_067345 3300042596 Bacteria 4675
74 Ga0466710_442615 3300042613 Bacteria 1572
75 Ga0466723_097479 3300042618 Bacteria 24080
76 Ga0466726_057287 3300042619 Bacteria 8850
77 Ga0466728_083471 3300042620 Bacteria 56340
78 Ga0466709_330757 3300042648 Bacteria 15272
79 Ga0466727_294126 3300042655 Bacteria 6812
80 Ga0466706_263337 3300042599 Bacteria 3153
81 Ga0466722_033255 3300042609 Bacteria 1707
82 Ga0123355_10021478 3300009826 Bacteria 10332
83 Ga0123355_10385141 3300009826 Bacteria 1823
84 Ga0123353_10034707 3300010167 Bacteria 7879
85 JGI24695J34938_10000060 3300002450 Bacteria 89148
86 Ga0068302_10020860 3300005071 Bacteria 16866
87 Ga0072941_1017680 3300005201 Bacteria 99064
88 Ga0072941_1406125 3300005201 Bacteria 1562
89 Ga0102737_1003423 3300007142 Unclassified 3624
90 Ga0103264_1028691 3300007188 Unclassified 2597
91 Ga0562378_0159 3300056814 Bacteria 168994
92 Ga0562375_0009 3300056856 Bacteria 1746158
93 Ga0160433_100144 3300012846 Bacteria 62485
94 Ga0466657_195928 3300042582 Bacteria 6358
95 Ga0466691_157204 3300042593 Bacteria 33688
96 Ga0466696_295642 3300042596 Bacteria 9835
97 Ga0466699_357355 3300042597 Bacteria 1354
98 Ga0466711_398117 3300042615 Bacteria 15142
99 Ga0466734_084436 3300042623 Bacteria 2436
100 Ga0466725_077079 3300042654 Bacteria 31530
101 Ga0466719_265532 3300042606 Bacteria 12717
102 Ga0123353_10220824 3300010167 Bacteria 2963
103 HBC_ctgsDRAFT_1000025 3300000333 Bacteria 37953
104 Ga0103266_1000007 3300007067 Bacteria 130661
105 Ga0562379_4041 3300056790 Bacteria 8277
106 Ga0466657_316048 3300042582 Bacteria 12805
107 Ga0466692_023483 3300042591 Bacteria 16465
108 Ga0466715_262837 3300042616 Bacteria 26057
109 Ga0466729_282476 3300042621 Bacteria 10369
110 Ga0466731_260835 3300042622 Bacteria 1202
111 Ga0466727_332161 3300042655 Bacteria 6469
112 Ga0466706_103297 3300042599 Bacteria 2637
113 Ga0466706_213436 3300042599 Bacteria 7006
114 Ga0466722_133429 3300042609 Bacteria 12238
115 Ga0466698_002867 3300042610 Bacteria 1775
116 Ga0123355_10203815 3300009826 Unclassified 2883
117 IMNBL1DRAFT_c0018074 3300000062 Bacteria 2942
118 JGI24702J35022_10163501 3300002462 Bacteria 1255
119 JGI24696J40584_12873947 3300002834 Bacteria 1056
120 Ga0068302_10045277 3300005071 Bacteria 6769
121 Ga0102736_1003179 3300007052 Unclassified 5021
122 Ga0103267_1000677 3300007190 Bacteria 20299

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042606 Ga0466719_350716 Ga0466719_350716_793_1395 200
2 3300007052 Ga0102736_1003179 Ga0102736_10031798 204
3 3300042616 Ga0466715_464220 Ga0466715_464220_15_677 204
4 3300042609 Ga0466722_133429 Ga0466722_133429_5793_6482 213
5 3300007188 Ga0103264_1028691 Ga0103264_10286915 215
6 3300042582 Ga0466657_195928 Ga0466657_195928_783_1451 222
7 3300042606 Ga0466719_265532 Ga0466719_265532_2451_3194 229
8 3300010167 Ga0123353_10034707 Ga0123353_1003470711 230
9 3300042596 Ga0466696_246206 Ga0466696_246206_3437_4183 232
10 3300042648 Ga0466709_330757 Ga0466709_330757_5704_6450 232
11 3300042596 Ga0466696_067345 Ga0466696_067345_3424_4128 234
12 iso_pr_bacteria 2820676843 2820678216 234
13 iso_pr_bacteria 2820696217 2820696667 234
14 3300002450 JGI24695J34938_10000473 JGI24695J34938_1000047312 235
15 3300042599 Ga0466706_103297 Ga0466706_103297_1502_2209 235
16 3300042610 Ga0466698_479961 Ga0466698_479961_44_754 236
17 3300042615 Ga0466711_398117 Ga0466711_398117_9252_9962 236
18 3300002450 JGI24695J34938_10000060 JGI24695J34938_1000006062 237
19 3300005071 Ga0068302_10020860 Ga0068302_100208602 237
20 3300010167 Ga0123353_10067941 Ga0123353_100679418 237
21 3300042597 Ga0466699_357355 Ga0466699_357355_282_995 237
22 3300042616 Ga0466715_181761 Ga0466715_181761_1814_2557 237
23 3300042619 Ga0466726_149647 Ga0466726_149647_2222_2965 237
24 iso_pr_bacteria 2819998259 2819998402 237
25 iso_pr_bacteria 2820010479 2820012463 237
26 3300002462 JGI24702J35022_10012338 JGI24702J35022_100123385 238
27 3300002462 JGI24702J35022_10126763 JGI24702J35022_101267632 238
28 3300007188 Ga0103264_1000489 Ga0103264_100048910 238
29 3300010167 Ga0123353_10429471 Ga0123353_104294713 238
30 3300000333 HBC_ctgsDRAFT_1000025 HBC_ctgsDRAFT_100002518 240
31 3300042550 Ga0466656_362369 Ga0466656_362369_1231_2010 240
32 iso_pr_bacteria 2920168565 2920169906 240
33 iso_pr_bacteria 2940228231 2940229522 240
34 3300002834 JGI24696J40584_12873947 JGI24696J40584_128739472 241
35 3300042606 Ga0466719_466443 Ga0466719_466443_3317_4063 241
36 3300042643 Ga0466704_088677 Ga0466704_088677_3969_4715 241
37 3300042624 Ga0466735_233356 Ga0466735_233356_246_989 242
38 3300010167 Ga0123353_10220824 Ga0123353_102208243 243
39 3300042611 Ga0466697_031221 Ga0466697_031221_102_833 243
40 3300007190 Ga0103267_1000677 Ga0103267_100067711 244
41 iso_pr_bacteria 2881902429 2881903234 244
42 3300009826 Ga0123355_10012631 Ga0123355_100126317 245
43 3300009826 Ga0123355_10385141 Ga0123355_103851412 245
44 3300042621 Ga0466729_282476 Ga0466729_282476_8007_8744 245
45 3300042655 Ga0466727_332161 Ga0466727_332161_1960_2697 245
46 3300005201 Ga0072941_1406125 Ga0072941_14061251 246
47 3300007188 Ga0103264_1017199 Ga0103264_10171992 246
48 3300012819 Ga0160468_100098 Ga0160468_10009897 246
49 3300012846 Ga0160433_100144 Ga0160433_10014456 246
50 3300042582 Ga0466657_316048 Ga0466657_316048_5047_5787 246
51 3300042654 Ga0466725_077079 Ga0466725_077079_13616_14356 246
52 3300010167 Ga0123353_10155822 Ga0123353_101558223 247
53 3300010167 Ga0123353_10215113 Ga0123353_102151131 247
54 3300042618 Ga0466723_097479 Ga0466723_097479_16697_17440 247
55 3300042619 Ga0466726_057287 Ga0466726_057287_3355_4098 247
56 3300042654 Ga0466725_142165 Ga0466725_142165_6484_7227 247
57 3300042655 Ga0466727_294126 Ga0466727_294126_2617_3360 247
58 iso_pr_bacteria 2603880173 2606036210 247
59 iso_pr_bacteria 2687453754 2690040187 247
60 iso_pr_bacteria 2687453755 2690043953 247
61 iso_pr_bacteria 2687453756 2690045782 247
62 iso_pr_bacteria 2820267566 2820270156 247
63 2225789004 2227133584 2227531723 248
64 2225789004 2227577403 2228126851 248
65 3300002934 CVPL005W_1000107 CVPL005W_100010722 248
66 3300005071 Ga0068302_10045277 Ga0068302_100452772 248
67 3300007142 Ga0102737_1003423 Ga0102737_10034232 248
68 3300007188 Ga0103264_1000462 Ga0103264_100046213 248
69 3300007192 Ga0103268_1000002 Ga0103268_100000230 248
70 3300042590 Ga0466690_266154 Ga0466690_266154_10440_11186 248
71 3300042592 Ga0466693_176964 Ga0466693_176964_93_839 248
72 3300042593 Ga0466691_157204 Ga0466691_157204_7312_8058 248
73 3300042596 Ga0466696_295642 Ga0466696_295642_1726_2472 248
74 3300042596 Ga0466696_306630 Ga0466696_306630_527_1273 248
75 3300042601 Ga0466707_271840 Ga0466707_271840_5556_6302 248
76 3300042602 Ga0466713_130567 Ga0466713_130567_13127_13912 248
77 3300042622 Ga0466731_260835 Ga0466731_260835_98_844 248
78 3300042636 Ga0466703_007779 Ga0466703_007779_5168_5914 248
79 3300042659 Ga0466733_217385 Ga0466733_217385_3539_4285 248
80 3300000062 IMNBL1DRAFT_c0040190 IMNBL1DRAFT_00401902 249
81 3300002462 JGI24702J35022_10001795 JGI24702J35022_100017958 249
82 3300002462 JGI24702J35022_10004250 JGI24702J35022_100042502 249
83 3300002462 JGI24702J35022_10163501 JGI24702J35022_101635012 249
84 3300007067 Ga0103266_1000007 Ga0103266_100000798 249
85 3300007095 Ga0102739_1005126 Ga0102739_10051262 249
86 3300042603 Ga0466714_028666 Ga0466714_028666_8288_9040 250
87 iso_pr_bacteria 2820737921 2820738872 250
88 3300002462 JGI24702J35022_10005031 JGI24702J35022_100050312 251
89 3300042599 Ga0466706_263337 Ga0466706_263337_61_816 251
90 3300007095 Ga0102739_1000071 Ga0102739_10000717 252
91 iso_pr_bacteria 2585428141 2588054327 253
92 3300007068 Ga0103265_1000023 Ga0103265_10000235 254
93 3300042609 Ga0466722_033255 Ga0466722_033255_356_1120 254
94 iso_pr_bacteria 2820393573 2820394988 254
95 3300005201 Ga0072941_1017680 Ga0072941_101768089 255
96 iso_pr_bacteria 2529293168 2531451536 255
97 iso_pr_bacteria 2820476618 2820476909 255
98 3300002931 CVPL010W_10001425 CVPL010W_1000142510 256
99 3300042591 Ga0466692_023483 Ga0466692_023483_230_1000 256
100 3300000062 IMNBL1DRAFT_c0018074 IMNBL1DRAFT_00180742 257
101 3300042613 Ga0466710_442615 Ga0466710_442615_321_1094 257
102 3300042616 Ga0466715_262837 Ga0466715_262837_21196_21969 257
103 3300009826 Ga0123355_10021478 Ga0123355_1002147812 258
104 3300042611 Ga0466697_126925 Ga0466697_126925_408_1184 258
105 3300042623 Ga0466734_084436 Ga0466734_084436_766_1542 258
106 3300042623 Ga0466734_137802 Ga0466734_137802_9273_10049 258
107 iso_pr_bacteria 2820856540 2820857222 258
108 iso_pr_bacteria 2820921285 2820921561 258
109 3300010167 Ga0123353_10011780 Ga0123353_100117805 259
110 iso_pr_bacteria 2820854745 2820855692 259
111 3300042654 Ga0466725_015802 Ga0466725_015802_186_968 260
112 3300042654 Ga0466725_464824 Ga0466725_464824_10678_11460 260
113 iso_pr_bacteria 2905310146 2905311060 260
114 3300009826 Ga0123355_10006233 Ga0123355_100062335 261
115 3300002501 JGI24703J35330_11744667 JGI24703J35330_117446673 262
116 3300002501 JGI24703J35330_11748186 JGI24703J35330_117481866 262
117 3300005071 Ga0068302_10005196 Ga0068302_100051967 262
118 3300009826 Ga0123355_10008773 Ga0123355_1000877312 262
119 3300009826 Ga0123355_10021683 Ga0123355_1002168310 262
120 3300009826 Ga0123355_10037586 Ga0123355_100375868 262
121 3300009826 Ga0123355_10371952 Ga0123355_103719522 262
122 3300026175 Ga0255572_1002002 Ga0255572_10020028 262
123 3300042599 Ga0466706_213436 Ga0466706_213436_3517_4305 262
124 3300042655 Ga0466727_034401 Ga0466727_034401_17815_18603 262
125 3300010167 Ga0123353_10002414 Ga0123353_100024142 263
126 iso_pr_bacteria 2524614537 2524833677 264
127 iso_pr_bacteria 2751185832 2753510963 264
128 iso_pr_bacteria 2843246524 2843250215 264
129 iso_pr_bacteria 2852123468 2852128352 264
130 iso_pr_bacteria 2855361764 2855362347 264
131 3300056790 Ga0562379_0049 Ga0562379_0049_414620_415417 265
132 3300056790 Ga0562379_0064 Ga0562379_0064_437374_438171 265
133 3300056790 Ga0562379_4041 Ga0562379_4041_3198_3995 265
134 3300056814 Ga0562378_0212 Ga0562378_0212_30093_30890 265
135 3300056814 Ga0562378_2199 Ga0562378_2199_5705_6502 265
136 3300042649 Ga0466724_06008 Ga0466724_06008_70_870 266
137 3300056856 Ga0562375_0009 Ga0562375_0009_703000_703800 266
138 iso_pr_bacteria 8018794549 8018797061 266
139 3300056814 Ga0562378_0030 Ga0562378_0030_172587_173390 267
140 3300056814 Ga0562378_0159 Ga0562378_0159_141271_142077 268
141 iso_pr_bacteria 8038268975 8038271704 268
142 iso_pr_bacteria 8108568626 8108571618 268
143 iso_pr_bacteria 8114555646 8114558638 268
144 3300057007 Ga0562374_1398 Ga0562374_1398_11693_12502 269
145 iso_pr_bacteria 2825804107 2825806820 269
146 3300009784 Ga0123357_10085767 Ga0123357_100857675 270
147 3300009826 Ga0123355_10203815 Ga0123355_102038153 270
148 iso_pr_bacteria 8007223943 8007225250 270
149 3300042619 Ga0466726_234364 Ga0466726_234364_22454_23269 271
150 3300042613 Ga0466710_126556 Ga0466710_126556_55_879 274
151 3300009826 Ga0123355_10040422 Ga0123355_100404226 280
152 3300042610 Ga0466698_002867 Ga0466698_002867_908_1753 281
153 3300042620 Ga0466728_083471 Ga0466728_083471_55104_55982 292
154 3300009826 Ga0123355_10202083 Ga0123355_102020832 306

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01255 Prenyltransf Putative undecaprenyl diphosphate synthase 66 290 0.95

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01255 GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.