Protein Family IF08383
Metagenome
Isolate
102
Members
51
Samples
100
Scaffolds
306.07
Avg Length
Representative Sequence
- ID
- 3300042620|Ga0466728_045475|Ga0466728_045475_14584_15609
- Length
- 341 aa
- Sequence
- MDVSETEIYSVQKLQKEHETPIRKMGAKGVTTVQNLKSIISVIRDFDFFAAEKWKIASDKHGSGNTANIGCSLNLEDLKNENGIFSQHANPHIINFYKSVQDGNITPLLMKQYLQEEGEKLRTAENNGYEHYLTVRSRFNSGAYSPFDFIFLSRAGFNGMMRFGSKGNWNIPFCKKPDRFAQAYVTKIVNQLDAVSQIIQPEPNWIFYNKSFTEIIPLATENDIIYCDPPYYGRHVDYYNGWTEKDEEQLFHLLLNTKAKFILSTWHHNDWRENEMTQKYWNIFNIITKDHFYHNGGNIENRRKVVEALVCNFNTDGFIQHNHGLKEKQIMKQLELLWDVV
Sample Types
Isolate
2.0%
Metagenome
98.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.9%
Kalotermitidae
28.6%
Termopsidae
8.2%
Unclassified
8.2%
Rhinotermitidae
6.1%
Hodotermitidae
2.0%
Drosophilidae
2.0%
Taxonomy
Archaea
0
Bacteria
97
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 8 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2820651690 | Unclassified Firmicutes Cu122P3bin6 | Isolate | Unclassified |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 21 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 22 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 23 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 29 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 35 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 41 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 42 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 43 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 44 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 45 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 46 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 47 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 48 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 49 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 50 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 51 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123354_10384696 | 3300010882 | Bacteria | 1207 |
| 2 | Ga0466711_486410 | 3300042615 | Bacteria | 5242 |
| 3 | Ga0466715_082793 | 3300042616 | Bacteria | 2933 |
| 4 | Ga0466728_268556 | 3300042620 | Bacteria | 4717 |
| 5 | Ga0466706_002649 | 3300042599 | Bacteria | 8843 |
| 6 | Ga0466706_225520 | 3300042599 | Bacteria | 1402 |
| 7 | Ga0466713_015711 | 3300042602 | Bacteria | 1797 |
| 8 | Ga0466704_372080 | 3300042643 | Bacteria | 34015 |
| 9 | Ga0123353_10501274 | 3300010167 | Bacteria | 1769 |
| 10 | Ga0466712_214464 | 3300042614 | Bacteria | 2846 |
| 11 | Ga0466711_414477 | 3300042615 | Bacteria | 2726 |
| 12 | Ga0466718_077710 | 3300042617 | Bacteria | 1878 |
| 13 | Ga0466718_125092 | 3300042617 | Bacteria | 2196 |
| 14 | Ga0466726_103817 | 3300042619 | Bacteria | 1497 |
| 15 | Ga0466706_075945 | 3300042599 | Bacteria | 30752 |
| 16 | Ga0466714_063555 | 3300042603 | Unclassified | 2231 |
| 17 | Ga0466722_011760 | 3300042609 | Bacteria | 8991 |
| 18 | Ga0466690_090970 | 3300042590 | Bacteria | 2295 |
| 19 | Ga0466692_006574 | 3300042591 | Bacteria | 2156 |
| 20 | Ga0466691_076795 | 3300042593 | Bacteria | 1260 |
| 21 | Ga0466691_091036 | 3300042593 | Bacteria | 2016 |
| 22 | Ga0466695_394711 | 3300042595 | Bacteria | 1142 |
| 23 | Ga0466709_374586 | 3300042648 | Bacteria | 2620 |
| 24 | Ga0466725_217886 | 3300042654 | Bacteria | 15833 |
| 25 | JGI24702J35022_10056768 | 3300002462 | Bacteria | 2089 |
| 26 | JGI24705J35276_12217049 | 3300002504 | Bacteria | 2074 |
| 27 | Ga0466723_141568 | 3300042618 | Bacteria | 16577 |
| 28 | Ga0466706_086327 | 3300042599 | Bacteria | 17752 |
| 29 | Ga0466700_247530 | 3300042600 | Bacteria | 1343 |
| 30 | Ga0466713_017332 | 3300042602 | Bacteria | 4851 |
| 31 | Ga0466720_225907 | 3300042607 | Bacteria | 2996 |
| 32 | Ga0466722_104282 | 3300042609 | Bacteria | 4379 |
| 33 | Ga0264413_117610 | 3300024493 | Bacteria | 4569 |
| 34 | Ga0466696_131287 | 3300042596 | Bacteria | 22542 |
| 35 | Ga0466703_359061 | 3300042636 | Bacteria | 19461 |
| 36 | Ga0466705_365579 | 3300042612 | Bacteria | 1575 |
| 37 | Ga0466715_295942 | 3300042616 | Bacteria | 1804 |
| 38 | Ga0466706_142021 | 3300042599 | Bacteria | 39871 |
| 39 | Ga0466707_261555 | 3300042601 | Bacteria | 5563 |
| 40 | Ga0466716_345393 | 3300042605 | Bacteria | 2364 |
| 41 | Ga0466698_383302 | 3300042610 | Bacteria | 1408 |
| 42 | Ga0466690_294514 | 3300042590 | Bacteria | 9309 |
| 43 | Ga0466729_212035 | 3300042621 | Bacteria | 9717 |
| 44 | Ga0466731_182158 | 3300042622 | Bacteria | 1147 |
| 45 | Ga0466703_350126 | 3300042636 | Bacteria | 10804 |
| 46 | Ga0466727_052136 | 3300042655 | Bacteria | 2095 |
| 47 | Ga0104042_1000210 | 3300007130 | Bacteria | 5330 |
| 48 | Ga0123353_10367365 | 3300010167 | Bacteria | 2159 |
| 49 | Ga0466711_124947 | 3300042615 | Bacteria | 7288 |
| 50 | Ga0466726_003943 | 3300042619 | Bacteria | 1756 |
| 51 | Ga0466726_401502 | 3300042619 | Bacteria | 2041 |
| 52 | Ga0466716_219151 | 3300042605 | Bacteria | 1449 |
| 53 | Ga0466716_303139 | 3300042605 | Bacteria | 6037 |
| 54 | Ga0466722_153298 | 3300042609 | Bacteria | 32266 |
| 55 | Ga0466722_186241 | 3300042609 | Bacteria | 4984 |
| 56 | Ga0466691_219925 | 3300042593 | Bacteria | 12755 |
| 57 | Ga0466696_019478 | 3300042596 | Bacteria | 14609 |
| 58 | Ga0466696_433058 | 3300042596 | Bacteria | 4495 |
| 59 | Ga0466699_334661 | 3300042597 | Bacteria | 2455 |
| 60 | Ga0466703_019396 | 3300042636 | Bacteria | 5056 |
| 61 | Ga0466704_620453 | 3300042643 | Bacteria | 6855 |
| 62 | Ga0466725_367698 | 3300042654 | Bacteria | 1337 |
| 63 | Ga0072941_1054076 | 3300005201 | Bacteria | 8388 |
| 64 | Ga0466705_015510 | 3300042612 | Bacteria | 6790 |
| 65 | Ga0466705_209785 | 3300042612 | Bacteria | 2776 |
| 66 | Ga0466711_121901 | 3300042615 | Bacteria | 3333 |
| 67 | Ga0466706_171013 | 3300042599 | Bacteria | 18233 |
| 68 | Ga0466707_005911 | 3300042601 | Bacteria | 16512 |
| 69 | Ga0466735_002309 | 3300042624 | Bacteria | 1184 |
| 70 | Ga0466708_158150 | 3300042652 | Bacteria | 1594 |
| 71 | JGI24697J35500_11274796 | 3300002507 | Unclassified | 9905 |
| 72 | Ga0466733_129534 | 3300042659 | Bacteria | 1193 |
| 73 | Ga0123357_10366941 | 3300009784 | Bacteria | 1355 |
| 74 | Ga0466723_167633 | 3300042618 | Bacteria | 11118 |
| 75 | Ga0466706_106204 | 3300042599 | Bacteria | 73373 |
| 76 | Ga0466706_126823 | 3300042599 | Bacteria | 4434 |
| 77 | Ga0466707_223296 | 3300042601 | Bacteria | 8350 |
| 78 | Ga0466691_023922 | 3300042593 | Bacteria | 6944 |
| 79 | Ga0466696_012684 | 3300042596 | Bacteria | 7511 |
| 80 | Ga0466704_550432 | 3300042643 | Bacteria | 2231 |
| 81 | Ga0466709_004798 | 3300042648 | Bacteria | 35368 |
| 82 | Ga0466709_419251 | 3300042648 | Bacteria | 2311 |
| 83 | Ga0466708_389687 | 3300042652 | Bacteria | 7181 |
| 84 | JGI24702J35022_10010216 | 3300002462 | Bacteria | 5255 |
| 85 | Ga0072941_1004251 | 3300005201 | Bacteria | 37842 |
| 86 | Ga0466705_121779 | 3300042612 | Bacteria | 3923 |
| 87 | Ga0466710_063107 | 3300042613 | Bacteria | 2069 |
| 88 | Ga0466723_266245 | 3300042618 | Bacteria | 2565 |
| 89 | Ga0466728_045475 | 3300042620 | Bacteria | 32823 |
| 90 | Ga0466713_095475 | 3300042602 | Bacteria | 20507 |
| 91 | Ga0466717_094195 | 3300042604 | Bacteria | 1781 |
| 92 | Ga0466719_340874 | 3300042606 | Unclassified | 4105 |
| 93 | Ga0466697_003323 | 3300042611 | Bacteria | 3170 |
| 94 | Ga0466702_024049 | 3300042635 | Bacteria | 2119 |
| 95 | Ga0466703_024200 | 3300042636 | Unclassified | 3604 |
| 96 | Ga0466703_052870 | 3300042636 | Bacteria | 3148 |
| 97 | Ga0466727_150567 | 3300042655 | Bacteria | 3100 |
| 98 | JGI24698J34947_10024021 | 3300002449 | Unclassified | 3257 |
| 99 | Ga0068302_10054327 | 3300005071 | Bacteria | 2744 |
| 100 | Ga0072941_1180910 | 3300005201 | Bacteria | 2142 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042595 | Ga0466695_394711 | Ga0466695_394711_101_976 | 281 |
| 2 | 3300042596 | Ga0466696_131287 | Ga0466696_131287_7117_7968 | 283 |
| 3 | 3300042615 | Ga0466711_121901 | Ga0466711_121901_873_1730 | 285 |
| 4 | 3300042604 | Ga0466717_094195 | Ga0466717_094195_598_1461 | 287 |
| 5 | 3300042615 | Ga0466711_124947 | Ga0466711_124947_3733_4665 | 289 |
| 6 | 3300042624 | Ga0466735_002309 | Ga0466735_002309_290_1159 | 289 |
| 7 | 3300042619 | Ga0466726_401502 | Ga0466726_401502_130_1056 | 294 |
| 8 | 3300042606 | Ga0466719_340874 | Ga0466719_340874_848_1774 | 296 |
| 9 | 3300042655 | Ga0466727_150567 | Ga0466727_150567_521_1450 | 296 |
| 10 | 3300005201 | Ga0072941_1180910 | Ga0072941_11809102 | 297 |
| 11 | 3300042601 | Ga0466707_261555 | Ga0466707_261555_1278_2198 | 300 |
| 12 | 3300042609 | Ga0466722_104282 | Ga0466722_104282_2519_3445 | 301 |
| 13 | 3300042605 | Ga0466716_303139 | Ga0466716_303139_2535_3443 | 302 |
| 14 | 3300042601 | Ga0466707_223296 | Ga0466707_223296_560_1471 | 303 |
| 15 | 3300042616 | Ga0466715_082793 | Ga0466715_082793_648_1559 | 303 |
| 16 | 3300042593 | Ga0466691_023922 | Ga0466691_023922_570_1484 | 304 |
| 17 | 3300042648 | Ga0466709_004798 | Ga0466709_004798_1372_2286 | 304 |
| 18 | iso_pr_bacteria | 2820651690 | 2820653288 | 304 |
| 19 | 3300024493 | Ga0264413_117610 | Ga0264413_1176103 | 305 |
| 20 | 3300042591 | Ga0466692_006574 | Ga0466692_006574_902_1819 | 305 |
| 21 | 3300042600 | Ga0466700_247530 | Ga0466700_247530_195_1112 | 305 |
| 22 | 3300042609 | Ga0466722_186241 | Ga0466722_186241_1151_2068 | 305 |
| 23 | 3300042610 | Ga0466698_383302 | Ga0466698_383302_204_1121 | 305 |
| 24 | 3300042618 | Ga0466723_141568 | Ga0466723_141568_9697_10614 | 305 |
| 25 | 3300042618 | Ga0466723_167633 | Ga0466723_167633_2163_3080 | 305 |
| 26 | 3300042643 | Ga0466704_550432 | Ga0466704_550432_563_1480 | 305 |
| 27 | 3300005201 | Ga0072941_1054076 | Ga0072941_10540767 | 306 |
| 28 | 3300042590 | Ga0466690_090970 | Ga0466690_090970_1055_1975 | 306 |
| 29 | 3300042599 | Ga0466706_075945 | Ga0466706_075945_17205_18146 | 306 |
| 30 | 3300042601 | Ga0466707_005911 | Ga0466707_005911_13769_14689 | 306 |
| 31 | 3300042603 | Ga0466714_063555 | Ga0466714_063555_1049_1969 | 306 |
| 32 | 3300042605 | Ga0466716_219151 | Ga0466716_219151_326_1246 | 306 |
| 33 | 3300042607 | Ga0466720_225907 | Ga0466720_225907_1250_2170 | 306 |
| 34 | 3300042609 | Ga0466722_011760 | Ga0466722_011760_1222_2142 | 306 |
| 35 | 3300042612 | Ga0466705_121779 | Ga0466705_121779_1499_2419 | 306 |
| 36 | 3300042612 | Ga0466705_365579 | Ga0466705_365579_392_1312 | 306 |
| 37 | 3300042613 | Ga0466710_063107 | Ga0466710_063107_892_1812 | 306 |
| 38 | 3300042614 | Ga0466712_214464 | Ga0466712_214464_1694_2614 | 306 |
| 39 | 3300042615 | Ga0466711_414477 | Ga0466711_414477_1378_2298 | 306 |
| 40 | 3300042616 | Ga0466715_295942 | Ga0466715_295942_34_954 | 306 |
| 41 | 3300042617 | Ga0466718_125092 | Ga0466718_125092_1099_2019 | 306 |
| 42 | 3300042618 | Ga0466723_266245 | Ga0466723_266245_1514_2434 | 306 |
| 43 | 3300042619 | Ga0466726_003943 | Ga0466726_003943_795_1715 | 306 |
| 44 | 3300042622 | Ga0466731_182158 | Ga0466731_182158_132_1052 | 306 |
| 45 | 3300042636 | Ga0466703_024200 | Ga0466703_024200_1609_2529 | 306 |
| 46 | 3300042655 | Ga0466727_052136 | Ga0466727_052136_232_1152 | 306 |
| 47 | 3300042659 | Ga0466733_129534 | Ga0466733_129534_130_1050 | 306 |
| 48 | 3300002449 | JGI24698J34947_10024021 | JGI24698J34947_100240213 | 307 |
| 49 | 3300002504 | JGI24705J35276_12217049 | JGI24705J35276_122170492 | 307 |
| 50 | 3300002507 | JGI24697J35500_11274796 | JGI24697J35500_112747965 | 307 |
| 51 | 3300005071 | Ga0068302_10054327 | Ga0068302_100543272 | 307 |
| 52 | 3300005201 | Ga0072941_1004251 | Ga0072941_100425112 | 307 |
| 53 | 3300010167 | Ga0123353_10367365 | Ga0123353_103673653 | 307 |
| 54 | 3300010882 | Ga0123354_10384696 | Ga0123354_103846961 | 307 |
| 55 | 3300042615 | Ga0466711_486410 | Ga0466711_486410_2907_3830 | 307 |
| 56 | 3300042617 | Ga0466718_077710 | Ga0466718_077710_831_1754 | 307 |
| 57 | 3300042652 | Ga0466708_389687 | Ga0466708_389687_310_1233 | 307 |
| 58 | iso_pr_bacteria | 2820741847 | 2820742162 | 307 |
| 59 | 3300002462 | JGI24702J35022_10010216 | JGI24702J35022_100102165 | 308 |
| 60 | 3300009784 | Ga0123357_10366941 | Ga0123357_103669412 | 308 |
| 61 | 3300010167 | Ga0123353_10501274 | Ga0123353_105012742 | 308 |
| 62 | 3300042590 | Ga0466690_294514 | Ga0466690_294514_1656_2582 | 308 |
| 63 | 3300042593 | Ga0466691_076795 | Ga0466691_076795_155_1081 | 308 |
| 64 | 3300042593 | Ga0466691_091036 | Ga0466691_091036_1005_1931 | 308 |
| 65 | 3300042593 | Ga0466691_219925 | Ga0466691_219925_1903_2829 | 308 |
| 66 | 3300042596 | Ga0466696_012684 | Ga0466696_012684_4058_4984 | 308 |
| 67 | 3300042597 | Ga0466699_334661 | Ga0466699_334661_1442_2368 | 308 |
| 68 | 3300042599 | Ga0466706_171013 | Ga0466706_171013_10432_11358 | 308 |
| 69 | 3300042602 | Ga0466713_015711 | Ga0466713_015711_745_1671 | 308 |
| 70 | 3300042602 | Ga0466713_095475 | Ga0466713_095475_4625_5551 | 308 |
| 71 | 3300042605 | Ga0466716_345393 | Ga0466716_345393_257_1183 | 308 |
| 72 | 3300042611 | Ga0466697_003323 | Ga0466697_003323_2140_3066 | 308 |
| 73 | 3300042612 | Ga0466705_209785 | Ga0466705_209785_1205_2131 | 308 |
| 74 | 3300042620 | Ga0466728_268556 | Ga0466728_268556_3521_4447 | 308 |
| 75 | 3300042621 | Ga0466729_212035 | Ga0466729_212035_964_1890 | 308 |
| 76 | 3300042635 | Ga0466702_024049 | Ga0466702_024049_471_1397 | 308 |
| 77 | 3300042636 | Ga0466703_019396 | Ga0466703_019396_2481_3407 | 308 |
| 78 | 3300042636 | Ga0466703_350126 | Ga0466703_350126_646_1572 | 308 |
| 79 | 3300042643 | Ga0466704_372080 | Ga0466704_372080_1767_2693 | 308 |
| 80 | 3300042643 | Ga0466704_620453 | Ga0466704_620453_2207_3133 | 308 |
| 81 | 3300042648 | Ga0466709_374586 | Ga0466709_374586_1462_2388 | 308 |
| 82 | 3300042648 | Ga0466709_419251 | Ga0466709_419251_1162_2088 | 308 |
| 83 | 3300042652 | Ga0466708_158150 | Ga0466708_158150_494_1420 | 308 |
| 84 | 3300042654 | Ga0466725_217886 | Ga0466725_217886_933_1859 | 308 |
| 85 | 3300042654 | Ga0466725_367698 | Ga0466725_367698_99_1025 | 308 |
| 86 | 3300042636 | Ga0466703_052870 | Ga0466703_052870_753_1682 | 309 |
| 87 | 3300042636 | Ga0466703_359061 | Ga0466703_359061_3316_4245 | 309 |
| 88 | 3300042599 | Ga0466706_086327 | Ga0466706_086327_9797_10729 | 310 |
| 89 | 3300042612 | Ga0466705_015510 | Ga0466705_015510_2659_3591 | 310 |
| 90 | 3300002462 | JGI24702J35022_10056768 | JGI24702J35022_100567681 | 311 |
| 91 | 3300042599 | Ga0466706_225520 | Ga0466706_225520_21_956 | 311 |
| 92 | 3300042602 | Ga0466713_017332 | Ga0466713_017332_1588_2523 | 311 |
| 93 | 3300042599 | Ga0466706_126823 | Ga0466706_126823_1237_2178 | 313 |
| 94 | 3300042609 | Ga0466722_153298 | Ga0466722_153298_2837_3778 | 313 |
| 95 | 3300042619 | Ga0466726_103817 | Ga0466726_103817_190_1131 | 313 |
| 96 | 3300042596 | Ga0466696_433058 | Ga0466696_433058_2980_3924 | 314 |
| 97 | 3300042599 | Ga0466706_002649 | Ga0466706_002649_2891_3835 | 314 |
| 98 | 3300042599 | Ga0466706_106204 | Ga0466706_106204_44581_45525 | 314 |
| 99 | 3300042599 | Ga0466706_142021 | Ga0466706_142021_1272_2216 | 314 |
| 100 | 3300007130 | Ga0104042_1000210 | Ga0104042_10002101 | 317 |
| 101 | 3300042596 | Ga0466696_019478 | Ga0466696_019478_10616_11572 | 318 |
| 102 | 3300042620 | Ga0466728_045475 | Ga0466728_045475_14584_15609 | 341 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.56 | 0.63 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.