Protein Family IF08380

Metagenome Isolate
147 Members
71 Samples
122 Scaffolds
212.33 Avg Length

🧬 Representative Sequence

ID
3300042620|Ga0466728_031710|Ga0466728_031710_521_1231
Length
236 aa
Sequence
MFLKNWKPSSAGLTVLAGSRIKVVMKKIFAKGTTILFQGDSVTDCHRARDDENSLGEGYPAKIAGIWELLFPQSGVRFLNRGISGNRTGDLLGRYEDDFAALKPDLISILIGINDTWRRYDRNNPTSTEKFEQNYRSLLEKLKRDLPAAAIVIMEPFLLDSDPAKRLWREDLDPKIQAVRNLAREFAGFFIPLDGILASYAAGGIKDADMSADGVHPSPQGHGIIAGEWLKALGVF

📊 Sample Types

Isolate 17.0%
Metagenome 83.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 23.1%
Kalotermitidae 21.5%
Termitidae 15.4%
Blattidae 13.8%
Culicidae 6.2%
Rhinotermitidae 4.6%
Termopsidae 4.6%
Tenebrionidae 3.1%
Armadillidiidae 3.1%
Scarabaeidae 3.1%
Passalidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 144
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
2 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
7 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
8 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
13 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
14 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
15 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
16 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
17 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
18 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
19 2508501067 Opitutaceae bacterium TAV1 Isolate Unclassified
20 2639763186 Opitutaceae bacterium TAV4 Isolate Unclassified
21 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
22 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
23 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
24 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
27 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
30 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
31 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
32 2820882373 Unclassified Actinobacteria Lab288P1bin45 Isolate Unclassified
33 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
34 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
35 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
36 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
37 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
40 2857493320 Opitutaceae bacterium TAV3 Isolate Unclassified
41 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
42 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
43 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
44 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
45 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
46 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
47 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
48 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
49 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
50 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
51 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
52 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
53 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
54 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
55 2517572100 Geminisphaera colitermitum TAV2 Isolate Unclassified
56 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
57 2857498920 Opitutaceae bacterium TAV4 Isolate Unclassified
58 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
59 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
60 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
61 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
62 2639763185 Opitutaceae bacterium TAV3 Isolate Unclassified
63 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
64 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
65 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
66 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
67 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
68 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
69 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
70 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
71 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0264413_148462 3300024493 Bacteria 1763
2 Ga0466692_079540 3300042591 Bacteria 1193
3 Ga0466694_324409 3300042594 Bacteria 9725
4 Ga0466726_465022 3300042619 Bacteria 2840
5 Ga0466702_439305 3300042635 Bacteria 4057
6 Ga0466704_273205 3300042643 Bacteria 9213
7 Ga0466704_372785 3300042643 Bacteria 1504
8 Ga0466708_251327 3300042652 Bacteria 2720
9 Ga0466727_081158 3300042655 Bacteria 1643
10 Ga0466727_231389 3300042655 Bacteria 3199
11 Ga0466716_532593 3300042605 Bacteria 3798
12 Ga0466733_051888 3300042659 Bacteria 1696
13 Ga0466705_414717 3300042612 Bacteria 9688
14 Ga0466711_162747 3300042615 Bacteria 5199
15 Ga0466728_031710 3300042620 Bacteria 1898
16 Ga0466735_145296 3300042624 Bacteria 1680
17 Ga0466703_093610 3300042636 Bacteria 45768
18 Ga0466703_246977 3300042636 Bacteria 6707
19 Ga0466703_292632 3300042636 Bacteria 1171
20 Ga0466707_405973 3300042601 Bacteria 1807
21 Ga0466716_084379 3300042605 Bacteria 6315
22 Ga0466719_562288 3300042606 Bacteria 8104
23 IMNBL1DRAFT_c0021081 3300000062 Bacteria 2618
24 Ga0466705_214300 3300042612 Bacteria 1475
25 Ga0466705_384428 3300042612 Bacteria 3178
26 Ga0160436_1000057 3300012861 Bacteria 60713
27 Ga0466692_075566 3300042591 Bacteria 3542
28 Ga0466696_086011 3300042596 Bacteria 6939
29 Ga0466696_380960 3300042596 Bacteria 4064
30 Ga0160442_100216 3300012806 Bacteria 45415
31 Ga0466711_309120 3300042615 Bacteria 3178
32 Ga0466715_544118 3300042616 Bacteria 2426
33 Ga0466702_001931 3300042635 Bacteria 1486
34 Ga0466702_196301 3300042635 Bacteria 4785
35 Ga0466702_372816 3300042635 Bacteria 2042
36 Ga0466704_005238 3300042643 Bacteria 12409
37 Ga0466727_033046 3300042655 Bacteria 1403
38 Ga0466727_034668 3300042655 Bacteria 1146
39 Ga0466727_227385 3300042655 Bacteria 3828
40 Ga0466727_267029 3300042655 Bacteria 1121
41 Ga0466707_355560 3300042601 Bacteria 1955
42 Ga0466719_196945 3300042606 Bacteria 2102
43 Ga0072941_1091563 3300005201 Bacteria 4451
44 Ga0466705_096802 3300042612 Bacteria 3971
45 Ga0160452_100824 3300012834 Bacteria 13211
46 Ga0160445_102035 3300012847 Bacteria 4980
47 Ga0123356_10176832 3300010049 Bacteria 2151
48 Ga0123353_10786674 3300010167 Bacteria 1317
49 Ga0466711_409536 3300042615 Bacteria 5304
50 Ga0466715_228639 3300042616 Bacteria 46039
51 Ga0466726_178376 3300042619 Bacteria 1305
52 Ga0466702_430672 3300042635 Bacteria 1140
53 Ga0466709_002938 3300042648 Bacteria 7524
54 Ga0068305_10304929 3300005083 Bacteria 1028
55 Ga0562378_0409 3300056814 Bacteria 78692
56 Ga0466694_008443 3300042594 Bacteria 8709
57 Ga0466696_067759 3300042596 Bacteria 4129
58 Ga0123353_10159843 3300010167 Bacteria 3588
59 Ga0160471_100012 3300012812 Bacteria 433895
60 Ga0466715_302518 3300042616 Bacteria 11190
61 Ga0466723_018371 3300042618 Bacteria 14236
62 Ga0466723_250435 3300042618 Bacteria 3346
63 Ga0466726_189794 3300042619 Bacteria 3887
64 Ga0466726_408560 3300042619 Bacteria 11299
65 Ga0466728_053228 3300042620 Bacteria 1464
66 Ga0466735_084788 3300042624 Bacteria 27734
67 Ga0466703_288405 3300042636 Bacteria 3359
68 Ga0466704_117530 3300042643 Bacteria 2471
69 Ga0466704_373046 3300042643 Bacteria 1893
70 Ga0466708_214029 3300042652 Bacteria 1368
71 Ga0466727_185131 3300042655 Bacteria 6356
72 Ga0466719_245527 3300042606 Unclassified 2024
73 Ga0466722_209348 3300042609 Bacteria 5157
74 Ga0562376_1444 3300056857 Bacteria 33390
75 Ga0160446_105327 3300012835 Bacteria 1842
76 Ga0466690_027322 3300042590 Bacteria 7052
77 Ga0466693_429639 3300042592 Bacteria 61681
78 Ga0466694_185997 3300042594 Bacteria 1405
79 Ga0466711_343442 3300042615 Bacteria 1488
80 Ga0466723_080919 3300042618 Bacteria 4815
81 Ga0466729_114557 3300042621 Bacteria 5857
82 Ga0466735_143656 3300042624 Bacteria 1330
83 Ga0466703_423953 3300042636 Bacteria 1735
84 Ga0466704_066525 3300042643 Bacteria 3409
85 Ga0466709_230563 3300042648 Bacteria 9888
86 Ga0466709_303144 3300042648 Bacteria 8359
87 Ga0466707_019816 3300042601 Bacteria 11178
88 Ga0466714_077896 3300042603 Bacteria 1442
89 Ga0466733_061981 3300042659 Bacteria 9950
90 Ga0160457_1000799 3300012858 Bacteria 11135
91 Ga0415639_029931 3300038395 Bacteria 1680
92 Ga0466690_094969 3300042590 Bacteria 9985
93 Ga0466691_035641 3300042593 Bacteria 4112
94 Ga0466691_041411 3300042593 Bacteria 9476
95 Ga0466696_081521 3300042596 Bacteria 15203
96 Ga0123353_10010947 3300010167 Bacteria 12720
97 Ga0160454_100474 3300012798 Bacteria 15193
98 Ga0160466_100735 3300012809 Bacteria 13289
99 Ga0466715_233938 3300042616 Bacteria 9949
100 Ga0466715_321032 3300042616 Bacteria 166710
101 Ga0466702_093780 3300042635 Bacteria 1509
102 Ga0466703_097273 3300042636 Bacteria 4691
103 Ga0466703_163052 3300042636 Unclassified 2527
104 Ga0466704_136231 3300042643 Unclassified 15716
105 Ga0466708_237493 3300042652 Bacteria 5960
106 Ga0466727_186077 3300042655 Bacteria 3848
107 Ga0466727_208732 3300042655 Bacteria 1133
108 Ga0466713_019780 3300042602 Bacteria 1982
109 Ga0466714_007640 3300042603 Bacteria 3704
110 Ga0466719_134639 3300042606 Bacteria 8094
111 Ga0123357_10000061 3300009784 Bacteria 85874
112 Ga0160435_1005136 3300012857 Bacteria 2991
113 Ga0123353_10172228 3300010167 Bacteria 3435
114 Ga0160442_100013 3300012806 Bacteria 424413
115 Ga0466723_140611 3300042618 Bacteria 44885
116 Ga0466726_469330 3300042619 Bacteria 1645
117 Ga0466735_202781 3300042624 Bacteria 4699
118 Ga0466703_139021 3300042636 Bacteria 6161
119 Ga0466704_299542 3300042643 Bacteria 2071
120 Ga0466708_300694 3300042652 Bacteria 12759
121 Ga0466707_178498 3300042601 Bacteria 2481
122 Ga0466722_096622 3300042609 Bacteria 1747

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_019816 Ga0466707_019816_1667_2266 199
2 3300042621 Ga0466729_114557 Ga0466729_114557_4397_4996 199
3 3300012858 Ga0160457_1000799 Ga0160457_10007998 200
4 3300012861 Ga0160436_1000057 Ga0160436_100005712 200
5 3300042624 Ga0466735_202781 Ga0466735_202781_3445_4050 201
6 iso_pr_bacteria 2820825283 2820826825 201
7 iso_pr_bacteria 2837204985 2837206316 203
8 iso_pr_bacteria 2883683260 2883683751 203
9 3300012857 Ga0160435_1005136 Ga0160435_10051362 204
10 3300042643 Ga0466704_372785 Ga0466704_372785_701_1315 204
11 3300042616 Ga0466715_228639 Ga0466715_228639_5882_6502 206
12 3300042603 Ga0466714_007640 Ga0466714_007640_429_1052 207
13 3300042603 Ga0466714_077896 Ga0466714_077896_724_1347 207
14 3300042636 Ga0466703_139021 Ga0466703_139021_543_1181 207
15 3300042636 Ga0466703_292632 Ga0466703_292632_463_1086 207
16 3300042655 Ga0466727_208732 Ga0466727_208732_307_930 207
17 3300000062 IMNBL1DRAFT_c0021081 IMNBL1DRAFT_00210813 208
18 3300042601 Ga0466707_355560 Ga0466707_355560_578_1204 208
19 3300042606 Ga0466719_134639 Ga0466719_134639_5927_6553 208
20 3300042612 Ga0466705_414717 Ga0466705_414717_7607_8233 208
21 3300042624 Ga0466735_145296 Ga0466735_145296_106_732 208
22 3300042643 Ga0466704_136231 Ga0466704_136231_7752_8378 208
23 3300042655 Ga0466727_034668 Ga0466727_034668_404_1030 208
24 iso_pr_bacteria 2940413413 2940414286 208
25 iso_pr_bacteria 2940419646 2940420923 208
26 iso_pr_bacteria 2940425923 2940427194 208
27 3300012798 Ga0160454_100474 Ga0160454_10047412 209
28 3300012835 Ga0160446_105327 Ga0160446_1053273 209
29 3300038395 Ga0415639_029931 Ga0415639_029931_155_784 209
30 3300042616 Ga0466715_321032 Ga0466715_321032_139349_139978 209
31 3300042635 Ga0466702_372816 Ga0466702_372816_1137_1766 209
32 3300042655 Ga0466727_081158 Ga0466727_081158_354_983 209
33 iso_pr_bacteria 2940380068 2940386249 209
34 iso_pr_bacteria 2940386776 2940392950 209
35 iso_pr_bacteria 2940393498 2940399658 209
36 iso_pr_bacteria 2940400224 2940406385 209
37 iso_pr_bacteria 2940406939 2940412916 209
38 3300042602 Ga0466713_019780 Ga0466713_019780_27_659 210
39 3300042609 Ga0466722_209348 Ga0466722_209348_2816_3448 210
40 3300042615 Ga0466711_343442 Ga0466711_343442_632_1264 210
41 3300042636 Ga0466703_288405 Ga0466703_288405_651_1283 210
42 iso_pr_bacteria 2681812870 2682013029 210
43 iso_pr_bacteria 2940221333 2940227255 210
44 3300010167 Ga0123353_10159843 Ga0123353_101598436 211
45 3300012847 Ga0160445_102035 Ga0160445_1020356 211
46 3300042591 Ga0466692_079540 Ga0466692_079540_499_1134 211
47 3300042592 Ga0466693_429639 Ga0466693_429639_8619_9254 211
48 3300042594 Ga0466694_008443 Ga0466694_008443_6924_7559 211
49 3300042601 Ga0466707_405973 Ga0466707_405973_228_863 211
50 3300042609 Ga0466722_096622 Ga0466722_096622_975_1610 211
51 3300042619 Ga0466726_465022 Ga0466726_465022_431_1066 211
52 3300042624 Ga0466735_143656 Ga0466735_143656_542_1177 211
53 3300042635 Ga0466702_001931 Ga0466702_001931_315_950 211
54 3300042635 Ga0466702_093780 Ga0466702_093780_475_1110 211
55 3300042635 Ga0466702_430672 Ga0466702_430672_253_954 211
56 3300042635 Ga0466702_439305 Ga0466702_439305_1793_2428 211
57 3300042655 Ga0466727_185131 Ga0466727_185131_1127_1762 211
58 iso_pr_bacteria 2517572100 2517754844 211
59 iso_pr_bacteria 2576861701 2579270960 211
60 iso_pr_bacteria 2639763185 2642343528 211
61 iso_pr_bacteria 2639763186 2642351094 211
62 iso_pr_bacteria 2857493320 2857497533 211
63 iso_pr_bacteria 2857498920 2857502956 211
64 3300024493 Ga0264413_148462 Ga0264413_1484622 212
65 3300042590 Ga0466690_027322 Ga0466690_027322_5221_5859 212
66 3300042590 Ga0466690_094969 Ga0466690_094969_1529_2167 212
67 3300042593 Ga0466691_035641 Ga0466691_035641_3362_4000 212
68 3300042593 Ga0466691_041411 Ga0466691_041411_1478_2116 212
69 3300042596 Ga0466696_081521 Ga0466696_081521_1039_1677 212
70 3300042596 Ga0466696_086011 Ga0466696_086011_4178_4816 212
71 3300042596 Ga0466696_380960 Ga0466696_380960_1184_1822 212
72 3300042605 Ga0466716_084379 Ga0466716_084379_5438_6076 212
73 3300042605 Ga0466716_532593 Ga0466716_532593_2268_2906 212
74 3300042606 Ga0466719_562288 Ga0466719_562288_852_1490 212
75 3300042612 Ga0466705_096802 Ga0466705_096802_2761_3399 212
76 3300042612 Ga0466705_384428 Ga0466705_384428_2118_2756 212
77 3300042615 Ga0466711_162747 Ga0466711_162747_1167_1805 212
78 3300042615 Ga0466711_309120 Ga0466711_309120_1092_1730 212
79 3300042616 Ga0466715_302518 Ga0466715_302518_9382_10020 212
80 3300042616 Ga0466715_544118 Ga0466715_544118_1285_1923 212
81 3300042618 Ga0466723_018371 Ga0466723_018371_12033_12671 212
82 3300042618 Ga0466723_080919 Ga0466723_080919_2973_3611 212
83 3300042618 Ga0466723_140611 Ga0466723_140611_910_1548 212
84 3300042618 Ga0466723_250435 Ga0466723_250435_946_1584 212
85 3300042619 Ga0466726_469330 Ga0466726_469330_187_825 212
86 3300042620 Ga0466728_053228 Ga0466728_053228_439_1077 212
87 3300042624 Ga0466735_084788 Ga0466735_084788_5071_5709 212
88 3300042636 Ga0466703_093610 Ga0466703_093610_34696_35334 212
89 3300042643 Ga0466704_066525 Ga0466704_066525_1765_2403 212
90 3300042643 Ga0466704_273205 Ga0466704_273205_6844_7482 212
91 3300042648 Ga0466709_002938 Ga0466709_002938_1643_2281 212
92 3300042648 Ga0466709_230563 Ga0466709_230563_2364_3002 212
93 3300042648 Ga0466709_303144 Ga0466709_303144_4492_5130 212
94 3300042652 Ga0466708_237493 Ga0466708_237493_4876_5514 212
95 3300042655 Ga0466727_186077 Ga0466727_186077_2277_2915 212
96 3300042655 Ga0466727_227385 Ga0466727_227385_696_1334 212
97 3300005083 Ga0068305_10304929 Ga0068305_103049292 213
98 3300012809 Ga0160466_100735 Ga0160466_1007356 213
99 3300042596 Ga0466696_067759 Ga0466696_067759_398_1039 213
100 3300042615 Ga0466711_409536 Ga0466711_409536_3451_4092 213
101 3300042619 Ga0466726_189794 Ga0466726_189794_2486_3127 213
102 3300042619 Ga0466726_408560 Ga0466726_408560_2998_3639 213
103 3300042635 Ga0466702_196301 Ga0466702_196301_1613_2254 213
104 3300042636 Ga0466703_097273 Ga0466703_097273_162_803 213
105 3300042636 Ga0466703_163052 Ga0466703_163052_1465_2106 213
106 3300042643 Ga0466704_117530 Ga0466704_117530_660_1301 213
107 3300042659 Ga0466733_061981 Ga0466733_061981_3763_4404 213
108 3300005201 Ga0072941_1091563 Ga0072941_10915635 214
109 3300042606 Ga0466719_245527 Ga0466719_245527_197_841 214
110 3300042636 Ga0466703_246977 Ga0466703_246977_4406_5050 214
111 iso_pr_bacteria 2508501067 2508840567 214
112 3300012812 Ga0160471_100012 Ga0160471_100012148 215
113 3300042601 Ga0466707_178498 Ga0466707_178498_32_682 216
114 3300042643 Ga0466704_299542 Ga0466704_299542_155_805 216
115 3300042652 Ga0466708_300694 Ga0466708_300694_2769_3419 216
116 3300010167 Ga0123353_10786674 Ga0123353_107866741 217
117 3300042606 Ga0466719_196945 Ga0466719_196945_1364_2017 217
118 3300042616 Ga0466715_233938 Ga0466715_233938_2917_3570 217
119 3300042619 Ga0466726_178376 Ga0466726_178376_546_1199 217
120 3300042643 Ga0466704_005238 Ga0466704_005238_6074_6727 217
121 3300042652 Ga0466708_251327 Ga0466708_251327_1009_1662 217
122 3300042655 Ga0466727_033046 Ga0466727_033046_11_664 217
123 3300042655 Ga0466727_267029 Ga0466727_267029_210_863 217
124 3300042659 Ga0466733_051888 Ga0466733_051888_212_865 217
125 3300012834 Ga0160452_100824 Ga0160452_1008245 218
126 3300042652 Ga0466708_214029 Ga0466708_214029_485_1141 218
127 3300012806 Ga0160442_100216 Ga0160442_10021624 219
128 3300042594 Ga0466694_185997 Ga0466694_185997_589_1248 219
129 3300042612 Ga0466705_214300 Ga0466705_214300_401_1060 219
130 3300042643 Ga0466704_373046 Ga0466704_373046_1032_1691 219
131 3300042655 Ga0466727_231389 Ga0466727_231389_1238_1897 219
132 3300056814 Ga0562378_0409 Ga0562378_0409_54992_55651 219
133 3300056857 Ga0562376_1444 Ga0562376_1444_21058_21717 219
134 iso_pr_bacteria 2781125688 2781422876 219
135 iso_pr_bacteria 2576861701 2579268676 220
136 3300012806 Ga0160442_100013 Ga0160442_10001394 221
137 3300042594 Ga0466694_324409 Ga0466694_324409_8479_9144 221
138 3300042636 Ga0466703_423953 Ga0466703_423953_823_1488 221
139 iso_pr_bacteria 2781125666 2781342911 221
140 3300009784 Ga0123357_10000061 Ga0123357_100000617 222
141 3300010167 Ga0123353_10172228 Ga0123353_101722282 222
142 3300042591 Ga0466692_075566 Ga0466692_075566_2398_3066 222
143 3300010049 Ga0123356_10176832 Ga0123356_101768322 223
144 iso_pr_bacteria 2820857933 2820859656 223
145 iso_pr_bacteria 2820882373 2820888396 223
146 3300010167 Ga0123353_10010947 Ga0123353_100109479 224
147 3300042620 Ga0466728_031710 Ga0466728_031710_521_1231 236

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 36 226 0.81
PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family 39 223 0.76

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00657 GO:0016788 hydrolase activity, acting on ester bonds MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.