Protein Family IF08368

Metagenome Isolate
155 Members
58 Samples
138 Scaffolds
276.9 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_486560|Ga0466726_486560_662_1558
Length
298 aa
Sequence
MNPTVLDLKFFQDKAPFFKTRLGTWFLKKLFHWAEINKVNEIHGKYCHLRGSAFTSAMLADPLMNVNYNIHNKEILDTLPKGAFITVSNHPIGSLDGIILIDIFAKLRPDFKVMVNEILAHISAMGDNFISVIPHTGENQDPNKQNVNGIRLSLGQLLNGHPMGFFPAGAVSFYNKTLHQVRDLTWAHSVIRLIRKAAVPIYPVYFDFLNTKVFYRWGRISWKLRLLRVAKEAFNKQGQTLDVYLGQPITPEIIGNISDDNELADFLYNATYWSLNSKKVKEKDIIKKNFLNIYNMIF

📊 Sample Types

Isolate 11.0%
Metagenome 89.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 30.4%
Kalotermitidae 25.0%
Termitidae 19.6%
Termopsidae 7.1%
Passalidae 5.4%
Unclassified 5.4%
Rhinotermitidae 5.4%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 153
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
2 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
3 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
4 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
5 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
6 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
7 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
8 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
9 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
10 3004672520 Bacteroides sp. 51 Isolate Blattidae
11 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
12 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
13 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
14 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
15 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
16 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
19 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
22 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
23 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
24 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
25 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
26 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
27 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
28 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
29 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
30 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
33 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
34 3004667792 Bacteroides sp. 519 Isolate Blattidae
35 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
36 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
37 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
38 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
39 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
40 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
41 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
42 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
43 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
44 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
45 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
46 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
47 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
48 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
49 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
50 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
51 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
52 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
53 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
54 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
55 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
56 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
57 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
58 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_096868 3300042659 Bacteria 74750
2 Ga0466715_276082 3300042616 Bacteria 11278
3 Ga0466719_158873 3300042606 Bacteria 5768
4 Ga0466722_014160 3300042609 Bacteria 11613
5 2227063698 2225789003 Bacteria 16706
6 IMNBL1DRAFT_c0001124 3300000062 Bacteria 20490
7 IMNBL1DRAFT_c0003741 3300000062 Bacteria 9531
8 Ga0466704_154577 3300042643 Bacteria 5663
9 Ga0466725_276656 3300042654 Bacteria 14850
10 Ga0466690_072790 3300042590 Bacteria 21646
11 Ga0466690_276324 3300042590 Bacteria 2066
12 Ga0466690_375807 3300042590 Bacteria 12353
13 Ga0466691_012716 3300042593 Bacteria 19248
14 Ga0466691_093973 3300042593 Bacteria 13680
15 Ga0466696_287535 3300042596 Bacteria 43348
16 Ga0466705_100030 3300042612 Bacteria 8932
17 Ga0466705_174208 3300042612 Bacteria 28798
18 Ga0466711_199823 3300042615 Bacteria 7379
19 Ga0466707_022637 3300042601 Bacteria 11587
20 Ga0466707_341657 3300042601 Bacteria 2481
21 Ga0466716_351854 3300042605 Bacteria 31697
22 Ga0068305_10027778 3300005083 Bacteria 27344
23 Ga0466735_191480 3300042624 Bacteria 1793
24 Ga0466703_182428 3300042636 Bacteria 6795
25 Ga0466703_233285 3300042636 Bacteria 5534
26 Ga0466704_073764 3300042643 Bacteria 58999
27 Ga0466704_116828 3300042643 Bacteria 10950
28 Ga0466656_235642 3300042550 Bacteria 2554
29 Ga0466657_322362 3300042582 Bacteria 1617
30 Ga0466692_179942 3300042591 Bacteria 100786
31 Ga0466705_472001 3300042612 Bacteria 3397
32 Ga0466723_070186 3300042618 Bacteria 30269
33 Ga0466726_486560 3300042619 Bacteria 2123
34 Ga0466722_245435 3300042609 Bacteria 23596
35 2227447479 2225789004 Bacteria 5436
36 2227447485 2225789004 Bacteria 5434
37 JGI24705J35276_12238107 3300002504 Bacteria 15966
38 Ga0068305_10031167 3300005083 Bacteria 9795
39 Ga0072941_1508486 3300005201 Unclassified 1521
40 Ga0466729_220506 3300042621 Bacteria 4187
41 Ga0466704_137344 3300042643 Bacteria 13243
42 Ga0466708_014247 3300042652 Bacteria 21773
43 Ga0265387_1008606 3300024582 Bacteria 1373
44 Ga0466705_111607 3300042612 Bacteria 1258
45 Ga0466711_075194 3300042615 Bacteria 13386
46 Ga0466715_286957 3300042616 Bacteria 6283
47 Ga0466723_049242 3300042618 Bacteria 72461
48 Ga0466728_016383 3300042620 Bacteria 48703
49 Ga0466700_128678 3300042600 Bacteria 4925
50 JGI24702J35022_10000173 3300002462 Bacteria 33823
51 Ga0068305_10097552 3300005083 Bacteria 14521
52 Ga0466735_086839 3300042624 Bacteria 1500
53 Ga0466703_148815 3300042636 Bacteria 16579
54 Ga0466703_232598 3300042636 Bacteria 11554
55 Ga0466703_250134 3300042636 Bacteria 18299
56 Ga0466704_094066 3300042643 Bacteria 24442
57 Ga0466709_004107 3300042648 Bacteria 9539
58 Ga0466727_316724 3300042655 Bacteria 6701
59 Ga0466705_156547 3300042612 Bacteria 6617
60 Ga0466710_432784 3300042613 Bacteria 1388
61 Ga0466715_083069 3300042616 Bacteria 26157
62 Ga0466715_128636 3300042616 Bacteria 28523
63 Ga0466715_482123 3300042616 Bacteria 15683
64 Ga0466726_024289 3300042619 Bacteria 9047
65 Ga0466719_051334 3300042606 Bacteria 11558
66 JGI24702J35022_10048175 3300002462 Bacteria 2269
67 JGI24702J35022_10131760 3300002462 Bacteria 1388
68 Ga0068302_10032364 3300005071 Unclassified 3339
69 Ga0068305_10305730 3300005083 Bacteria 3872
70 Ga0466704_170204 3300042643 Bacteria 3918
71 Ga0466704_491253 3300042643 Bacteria 4056
72 Ga0466727_138028 3300042655 Bacteria 18367
73 Ga0466727_201028 3300042655 Bacteria 11677
74 Ga0466690_113175 3300042590 Bacteria 17999
75 Ga0466690_185291 3300042590 Bacteria 4002
76 Ga0466690_245129 3300042590 Bacteria 16092
77 Ga0466690_396116 3300042590 Bacteria 22996
78 Ga0466692_205471 3300042591 Bacteria 27218
79 Ga0466691_017347 3300042593 Bacteria 27633
80 Ga0466696_015606 3300042596 Bacteria 14692
81 Ga0466696_217627 3300042596 Bacteria 13048
82 Ga0466696_341247 3300042596 Bacteria 22034
83 Ga0466711_009294 3300042615 Bacteria 6431
84 Ga0466723_165155 3300042618 Bacteria 30063
85 Ga0466728_313391 3300042620 Bacteria 9508
86 Ga0466707_417139 3300042601 Bacteria 1343
87 Ga0466713_131527 3300042602 Bacteria 55397
88 Ga0466714_029794 3300042603 Bacteria 42861
89 Ga0466716_340066 3300042605 Bacteria 22650
90 Ga0466703_004639 3300042636 Bacteria 9442
91 Ga0466703_043658 3300042636 Bacteria 3317
92 Ga0466727_202107 3300042655 Bacteria 7371
93 Ga0466696_059060 3300042596 Bacteria 8993
94 Ga0466697_111290 3300042611 Bacteria 3464
95 Ga0466705_170838 3300042612 Bacteria 23934
96 Ga0466711_028440 3300042615 Bacteria 19103
97 Ga0466711_083476 3300042615 Bacteria 22236
98 Ga0466715_546218 3300042616 Bacteria 6555
99 Ga0466723_200935 3300042618 Bacteria 15193
100 Ga0466706_074142 3300042599 Bacteria 4572
101 Ga0466713_010003 3300042602 Bacteria 49152
102 Ga0466713_072265 3300042602 Bacteria 40264
103 Ga0466713_131403 3300042602 Bacteria 18174
104 Ga0466716_151716 3300042605 Bacteria 6578
105 Ga0466716_406042 3300042605 Bacteria 10247
106 Ga0466719_388022 3300042606 Bacteria 1784
107 2227479082 2225789004 Bacteria 4510
108 IMNBL1DRAFT_c0000298 3300000062 Bacteria 42272
109 JGI24702J35022_10003307 3300002462 Bacteria 9734
110 Ga0072941_1037155 3300005201 Bacteria 1011
111 Ga0466704_195693 3300042643 Bacteria 31218
112 Ga0466709_265193 3300042648 Bacteria 3862
113 Ga0466709_274511 3300042648 Bacteria 1222
114 Ga0466725_035263 3300042654 Bacteria 13140
115 Ga0466727_227644 3300042655 Bacteria 3823
116 Ga0466710_436157 3300042613 Bacteria 1224
117 Ga0466711_036637 3300042615 Bacteria 5511
118 Ga0466715_193888 3300042616 Bacteria 87863
119 Ga0466723_236425 3300042618 Bacteria 5358
120 Ga0466726_162992 3300042619 Bacteria 3597
121 Ga0466726_305190 3300042619 Bacteria 6378
122 Ga0466726_485037 3300042619 Bacteria 18142
123 Ga0466707_360201 3300042601 Bacteria 12907
124 Ga0466719_229549 3300042606 Bacteria 20920
125 Ga0466722_178845 3300042609 Bacteria 79493
126 Ga0466697_005831 3300042611 Bacteria 1912
127 Ga0068305_10001970 3300005083 Bacteria 23230
128 Ga0068305_10011097 3300005083 Bacteria 15891
129 Ga0466735_074304 3300042624 Bacteria 1890
130 Ga0466702_459107 3300042635 Bacteria 1306
131 Ga0466703_028432 3300042636 Bacteria 36646
132 Ga0466704_062557 3300042643 Bacteria 13240
133 Ga0466704_345357 3300042643 Bacteria 5171
134 Ga0466709_170961 3300042648 Bacteria 6157
135 Ga0466708_060683 3300042652 Bacteria 49198
136 Ga0466708_367106 3300042652 Bacteria 72455
137 Ga0466727_057671 3300042655 Bacteria 13388
138 Ga0466696_117970 3300042596 Bacteria 23257

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005071 Ga0068302_10032364 Ga0068302_100323644 261
2 3300042613 Ga0466710_436157 Ga0466710_436157_35_826 263
3 3300005201 Ga0072941_1508486 Ga0072941_15084862 266
4 3300002462 JGI24702J35022_10048175 JGI24702J35022_100481752 270
5 3300042636 Ga0466703_232598 Ga0466703_232598_2324_3154 270
6 3300002462 JGI24702J35022_10003307 JGI24702J35022_100033079 273
7 3300042612 Ga0466705_111607 Ga0466705_111607_121_942 273
8 3300042643 Ga0466704_345357 Ga0466704_345357_1525_2346 273
9 3300005083 Ga0068305_10027778 Ga0068305_100277787 274
10 3300042550 Ga0466656_235642 Ga0466656_235642_502_1326 274
11 3300042582 Ga0466657_322362 Ga0466657_322362_59_883 274
12 3300042590 Ga0466690_245129 Ga0466690_245129_10057_10881 274
13 3300042596 Ga0466696_217627 Ga0466696_217627_12199_13023 274
14 3300042596 Ga0466696_341247 Ga0466696_341247_9111_9935 274
15 3300042601 Ga0466707_417139 Ga0466707_417139_475_1299 274
16 3300042602 Ga0466713_010003 Ga0466713_010003_24707_25531 274
17 3300042602 Ga0466713_131403 Ga0466713_131403_8847_9671 274
18 3300042605 Ga0466716_406042 Ga0466716_406042_714_1538 274
19 3300042606 Ga0466719_158873 Ga0466719_158873_4190_5014 274
20 3300042606 Ga0466719_229549 Ga0466719_229549_18159_18983 274
21 3300042616 Ga0466715_083069 Ga0466715_083069_17529_18353 274
22 3300042616 Ga0466715_546218 Ga0466715_546218_3748_4572 274
23 3300042619 Ga0466726_305190 Ga0466726_305190_3893_4717 274
24 3300042619 Ga0466726_485037 Ga0466726_485037_13358_14182 274
25 3300042620 Ga0466728_016383 Ga0466728_016383_35018_35842 274
26 3300042636 Ga0466703_182428 Ga0466703_182428_5091_5915 274
27 3300042643 Ga0466704_094066 Ga0466704_094066_3387_4211 274
28 3300042648 Ga0466709_265193 Ga0466709_265193_2936_3760 274
29 3300042654 Ga0466725_276656 Ga0466725_276656_11681_12505 274
30 3300042655 Ga0466727_138028 Ga0466727_138028_9023_9847 274
31 3300042655 Ga0466727_202107 Ga0466727_202107_4530_5354 274
32 3300042659 Ga0466733_096868 Ga0466733_096868_51008_51832 274
33 3300005083 Ga0068305_10011097 Ga0068305_100110971 275
34 3300042590 Ga0466690_113175 Ga0466690_113175_2485_3312 275
35 3300042590 Ga0466690_185291 Ga0466690_185291_2704_3531 275
36 3300042593 Ga0466691_012716 Ga0466691_012716_11198_12025 275
37 3300042593 Ga0466691_017347 Ga0466691_017347_18108_18935 275
38 3300042596 Ga0466696_059060 Ga0466696_059060_3737_4564 275
39 3300042600 Ga0466700_128678 Ga0466700_128678_160_987 275
40 3300042605 Ga0466716_340066 Ga0466716_340066_3816_4643 275
41 3300042611 Ga0466697_111290 Ga0466697_111290_1147_1974 275
42 3300042615 Ga0466711_009294 Ga0466711_009294_4336_5163 275
43 3300042615 Ga0466711_028440 Ga0466711_028440_16948_17775 275
44 3300042615 Ga0466711_083476 Ga0466711_083476_2441_3268 275
45 3300042616 Ga0466715_193888 Ga0466715_193888_82892_83719 275
46 3300042618 Ga0466723_070186 Ga0466723_070186_23867_24694 275
47 3300042624 Ga0466735_074304 Ga0466735_074304_240_1067 275
48 3300042624 Ga0466735_086839 Ga0466735_086839_268_1095 275
49 3300042635 Ga0466702_459107 Ga0466702_459107_285_1112 275
50 3300042636 Ga0466703_233285 Ga0466703_233285_4485_5312 275
51 3300042636 Ga0466703_250134 Ga0466703_250134_2143_2970 275
52 3300042652 Ga0466708_014247 Ga0466708_014247_12905_13732 275
53 3300042652 Ga0466708_367106 Ga0466708_367106_14673_15500 275
54 3300042655 Ga0466727_057671 Ga0466727_057671_1457_2284 275
55 iso_pr_bacteria 2940199050 2940199196 275
56 iso_pr_bacteria 2940209341 2940210389 275
57 iso_pr_bacteria 2940346213 2940346255 275
58 2225789004 2227447479 2227885038 276
59 3300000062 IMNBL1DRAFT_c0001124 IMNBL1DRAFT_000112414 276
60 3300002504 JGI24705J35276_12238107 JGI24705J35276_1223810718 276
61 3300005083 Ga0068305_10001970 Ga0068305_1000197019 276
62 3300042601 Ga0466707_022637 Ga0466707_022637_2991_3821 276
63 3300042601 Ga0466707_341657 Ga0466707_341657_681_1511 276
64 3300042602 Ga0466713_131527 Ga0466713_131527_4679_5509 276
65 3300042611 Ga0466697_005831 Ga0466697_005831_670_1500 276
66 3300042612 Ga0466705_174208 Ga0466705_174208_425_1255 276
67 3300042612 Ga0466705_472001 Ga0466705_472001_874_1704 276
68 3300042613 Ga0466710_432784 Ga0466710_432784_110_940 276
69 3300042615 Ga0466711_036637 Ga0466711_036637_2186_3016 276
70 3300042615 Ga0466711_075194 Ga0466711_075194_10015_10845 276
71 3300042615 Ga0466711_199823 Ga0466711_199823_5072_5902 276
72 3300042616 Ga0466715_286957 Ga0466715_286957_588_1418 276
73 3300042618 Ga0466723_236425 Ga0466723_236425_2238_3068 276
74 3300042643 Ga0466704_073764 Ga0466704_073764_47322_48152 276
75 3300042643 Ga0466704_195693 Ga0466704_195693_29963_30793 276
76 3300042655 Ga0466727_227644 Ga0466727_227644_2564_3394 276
77 iso_pr_bacteria 3004672520 3004675649 276
78 3300000062 IMNBL1DRAFT_c0003741 IMNBL1DRAFT_00037415 277
79 3300002462 JGI24702J35022_10000173 JGI24702J35022_1000017311 277
80 3300005083 Ga0068305_10031167 Ga0068305_100311677 277
81 3300042593 Ga0466691_093973 Ga0466691_093973_12638_13471 277
82 3300042601 Ga0466707_360201 Ga0466707_360201_8090_8923 277
83 3300042609 Ga0466722_014160 Ga0466722_014160_7632_8465 277
84 3300042609 Ga0466722_178845 Ga0466722_178845_38823_39656 277
85 3300042609 Ga0466722_245435 Ga0466722_245435_6815_7648 277
86 3300042616 Ga0466715_276082 Ga0466715_276082_1995_2828 277
87 3300042619 Ga0466726_162992 Ga0466726_162992_1693_2526 277
88 3300042621 Ga0466729_220506 Ga0466729_220506_1895_2728 277
89 3300042624 Ga0466735_191480 Ga0466735_191480_104_937 277
90 3300042636 Ga0466703_028432 Ga0466703_028432_16111_16944 277
91 3300042636 Ga0466703_148815 Ga0466703_148815_3571_4404 277
92 3300042643 Ga0466704_062557 Ga0466704_062557_436_1269 277
93 iso_pr_bacteria 2940205530 2940207630 277
94 iso_pr_bacteria 2940212447 2940214545 277
95 iso_pr_bacteria 2940298504 2940300599 277
96 iso_pr_bacteria 2940302308 2940304396 277
97 iso_pr_bacteria 2940306115 2940307960 277
98 iso_pr_bacteria 2940309933 2940311777 277
99 iso_pr_bacteria 2940313741 2940315612 277
100 iso_pr_bacteria 2940317558 2940319427 277
101 iso_pr_bacteria 2940321370 2940323672 277
102 iso_pr_bacteria 2940325180 2940327273 277
103 iso_pr_bacteria 2940328985 2940331072 277
104 iso_pr_bacteria 2940332795 2940334664 277
105 3300005083 Ga0068305_10305730 Ga0068305_103057303 278
106 3300042590 Ga0466690_072790 Ga0466690_072790_561_1397 278
107 3300042590 Ga0466690_276324 Ga0466690_276324_77_913 278
108 3300042596 Ga0466696_117970 Ga0466696_117970_9575_10411 278
109 3300042602 Ga0466713_072265 Ga0466713_072265_21970_22806 278
110 3300042605 Ga0466716_351854 Ga0466716_351854_17375_18211 278
111 3300042606 Ga0466719_051334 Ga0466719_051334_1046_1882 278
112 3300042612 Ga0466705_156547 Ga0466705_156547_1996_2832 278
113 3300042616 Ga0466715_482123 Ga0466715_482123_1077_1913 278
114 3300042620 Ga0466728_313391 Ga0466728_313391_8499_9335 278
115 3300042636 Ga0466703_004639 Ga0466703_004639_226_1062 278
116 3300042643 Ga0466704_116828 Ga0466704_116828_2575_3411 278
117 3300042643 Ga0466704_154577 Ga0466704_154577_4287_5123 278
118 3300042643 Ga0466704_170204 Ga0466704_170204_541_1377 278
119 3300042648 Ga0466709_004107 Ga0466709_004107_2760_3596 278
120 3300005083 Ga0068305_10097552 Ga0068305_100975524 279
121 3300005201 Ga0072941_1037155 Ga0072941_10371552 279
122 3300024582 Ga0265387_1008606 Ga0265387_10086061 279
123 3300042591 Ga0466692_179942 Ga0466692_179942_96562_97401 279
124 3300042591 Ga0466692_205471 Ga0466692_205471_23290_24129 279
125 3300042596 Ga0466696_287535 Ga0466696_287535_42118_42957 279
126 3300042599 Ga0466706_074142 Ga0466706_074142_2746_3585 279
127 3300042618 Ga0466723_165155 Ga0466723_165155_11540_12379 279
128 3300042636 Ga0466703_043658 Ga0466703_043658_2140_2979 279
129 3300042643 Ga0466704_491253 Ga0466704_491253_628_1467 279
130 3300042655 Ga0466727_316724 Ga0466727_316724_3075_3914 279
131 2225789003 2227063698 2227419637 280
132 3300002462 JGI24702J35022_10131760 JGI24702J35022_101317602 280
133 3300042596 Ga0466696_015606 Ga0466696_015606_760_1602 280
134 3300042605 Ga0466716_151716 Ga0466716_151716_3323_4165 280
135 3300042612 Ga0466705_170838 Ga0466705_170838_9694_10536 280
136 3300042616 Ga0466715_128636 Ga0466715_128636_6866_7708 280
137 3300042643 Ga0466704_137344 Ga0466704_137344_9875_10717 280
138 3300042648 Ga0466709_274511 Ga0466709_274511_173_1015 280
139 iso_pr_bacteria 3004667792 3004672205 280
140 3300000062 IMNBL1DRAFT_c0000298 IMNBL1DRAFT_000029830 281
141 3300042648 Ga0466709_170961 Ga0466709_170961_5267_6112 281
142 3300042655 Ga0466727_201028 Ga0466727_201028_5344_6336 281
143 2225789004 2227447485 2227885078 282
144 2225789004 2227479082 2227935093 282
145 3300042654 Ga0466725_035263 Ga0466725_035263_4719_5567 282
146 3300042590 Ga0466690_375807 Ga0466690_375807_9000_9851 283
147 3300042603 Ga0466714_029794 Ga0466714_029794_8895_9746 283
148 3300042618 Ga0466723_049242 Ga0466723_049242_53678_54529 283
149 3300042612 Ga0466705_100030 Ga0466705_100030_3775_4629 284
150 3300042652 Ga0466708_060683 Ga0466708_060683_12324_13178 284
151 3300042618 Ga0466723_200935 Ga0466723_200935_14108_14974 288
152 3300042590 Ga0466690_396116 Ga0466690_396116_18316_19185 289
153 3300042606 Ga0466719_388022 Ga0466719_388022_661_1533 290
154 3300042619 Ga0466726_024289 Ga0466726_024289_2105_2980 291
155 3300042619 Ga0466726_486560 Ga0466726_486560_662_1558 298

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF19576 Acyltransf_2 Acyltransferase 13 277 0.84
PF01553 Acyltransferase Acyltransferase 69 206 0.79

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01553 GO:0016746 acyltransferase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.