Protein Family IF08360

Metagenome Isolate
138 Members
30 Samples
137 Scaffolds
317.02 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_465311|Ga0466726_465311_976_2031
Length
351 aa
Sequence
MVLQSKLYPAVLPGFAPMAAAAGQYSLRRKFMKVKAFILTAVLFAALVFGAYAKGGAQGTQQIRMATGGNTGTYYAYGSAVGQILTEKTGIPITIQSTGASKANIQLIAAGDVELAIVQNDVMDYAYKGIDLFNGEKITAFSTMAALYAEVCQVVANPASGIRTIADLKGKNVSVGDAGSGTELNARQILEAYGVTFDDIRKQNLSFGASADALRDNKIDAFFCVAGAPTTAIVDLAIGKEIVVLDIDDAHAVALSQKYPFYTQFPIPAGSYRGQNSAVKTVAVKATFIVSTKLSDDTVYSLTKNLLESKQAIVAAHAKGSELSSEYAVSGISVPFHPGAEKYLREIGALK

📊 Sample Types

Isolate 0.7%
Metagenome 99.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 46.7%
Termitidae 16.7%
Unclassified 10.0%
Rhinotermitidae 10.0%
Termopsidae 10.0%
Hodotermitidae 3.3%
Passalidae 3.3%

🌳 Taxonomy

Archaea 1
Bacteria 114
Eukaryota 0
Viruses 0
Unclassified 23

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
3 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
4 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
5 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
6 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
7 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
8 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
11 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
14 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
15 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
16 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
21 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
22 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
23 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
24 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
25 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
26 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
27 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
28 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
29 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
30 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466715_440436 3300042616 Bacteria 24382
2 Ga0466715_541118 3300042616 Bacteria 23249
3 Ga0466723_074762 3300042618 Bacteria 12215
4 Ga0466726_057695 3300042619 Bacteria 1965
5 Ga0466713_087932 3300042602 Bacteria 24748
6 Ga0466722_165807 3300042609 Bacteria 19197
7 Ga0466692_094517 3300042591 Unclassified 2408
8 Ga0466692_183837 3300042591 Bacteria 23012
9 Ga0466691_067489 3300042593 Bacteria 5349
10 Ga0466696_329025 3300042596 Bacteria 7950
11 Ga0466696_403183 3300042596 Unclassified 1256
12 Ga0466703_150251 3300042636 Unclassified 2799
13 Ga0466704_273998 3300042643 Unclassified 2246
14 Ga0466708_080950 3300042652 Unclassified 2426
15 Ga0466708_085239 3300042652 Bacteria 30570
16 Ga0466727_082501 3300042655 Bacteria 1734
17 Ga0466711_476427 3300042615 Bacteria 3345
18 Ga0466726_299586 3300042619 Bacteria 28168
19 Ga0466713_156709 3300042602 Bacteria 2709
20 Ga0466716_103489 3300042605 Bacteria 23373
21 Ga0466722_019497 3300042609 Bacteria 4818
22 Ga0466722_054085 3300042609 Bacteria 6871
23 Ga0466692_144206 3300042591 Unclassified 2456
24 Ga0466691_063397 3300042593 Bacteria 3844
25 Ga0466696_041253 3300042596 Bacteria 18008
26 Ga0466703_031517 3300042636 Bacteria 15283
27 Ga0466703_206719 3300042636 Bacteria 8783
28 Ga0466703_213291 3300042636 Bacteria 34230
29 Ga0466704_502947 3300042643 Bacteria 3931
30 Ga0466708_077091 3300042652 Bacteria 2296
31 Ga0466708_152751 3300042652 Bacteria 9068
32 Ga0466733_022732 3300042659 Bacteria 28799
33 Ga0466726_465311 3300042619 Bacteria 2786
34 Ga0466716_203659 3300042605 Bacteria 2793
35 Ga0466719_016516 3300042606 Bacteria 10555
36 Ga0466719_277749 3300042606 Bacteria 18545
37 Ga0466722_009039 3300042609 Bacteria 23176
38 Ga0466722_197828 3300042609 Unclassified 1139
39 Ga0466690_016976 3300042590 Unclassified 9145
40 Ga0466692_010681 3300042591 Bacteria 32497
41 Ga0466692_202113 3300042591 Bacteria 3225
42 Ga0466691_016325 3300042593 Bacteria 11766
43 Ga0466703_060394 3300042636 Bacteria 7926
44 Ga0466704_409051 3300042643 Bacteria 10608
45 Ga0466709_150515 3300042648 Bacteria 8213
46 Ga0466709_239318 3300042648 Unclassified 3882
47 Ga0466708_303006 3300042652 Unclassified 1743
48 Ga0466705_271200 3300042612 Bacteria 5897
49 Ga0466711_016323 3300042615 Bacteria 32034
50 Ga0466715_295077 3300042616 Bacteria 8106
51 Ga0466723_161240 3300042618 Bacteria 5420
52 Ga0466723_360356 3300042618 Bacteria 17355
53 Ga0466726_117995 3300042619 Archaea 1424
54 Ga0466726_177351 3300042619 Bacteria 2415
55 Ga0466726_206714 3300042619 Bacteria 4658
56 Ga0466728_339243 3300042620 Bacteria 11162
57 Ga0466707_203220 3300042601 Bacteria 2214
58 Ga0466716_068037 3300042605 Unclassified 2677
59 Ga0466716_308675 3300042605 Unclassified 7685
60 Ga0466716_312354 3300042605 Bacteria 2875
61 Ga0466722_022089 3300042609 Bacteria 10999
62 Ga0466690_030572 3300042590 Bacteria 18022
63 Ga0466690_283388 3300042590 Bacteria 14677
64 Ga0466692_008402 3300042591 Bacteria 5328
65 Ga0466691_053028 3300042593 Unclassified 2946
66 Ga0466704_135516 3300042643 Bacteria 50760
67 Ga0466727_224371 3300042655 Bacteria 12973
68 Ga0466705_083588 3300042612 Bacteria 10237
69 Ga0466705_203390 3300042612 Bacteria 5234
70 Ga0466733_207889 3300042659 Bacteria 3100
71 Ga0466726_210047 3300042619 Bacteria 4241
72 Ga0466706_007306 3300042599 Bacteria 3361
73 Ga0466719_041733 3300042606 Bacteria 9409
74 Ga0466719_224892 3300042606 Bacteria 1901
75 Ga0466719_442352 3300042606 Bacteria 4981
76 Ga0466692_118660 3300042591 Bacteria 2325
77 Ga0466691_120832 3300042593 Bacteria 3914
78 Ga0466691_149608 3300042593 Unclassified 17073
79 Ga0466691_217358 3300042593 Bacteria 12281
80 Ga0466729_227763 3300042621 Bacteria 2464
81 Ga0466735_010612 3300042624 Bacteria 8361
82 Ga0466704_332025 3300042643 Bacteria 4223
83 Ga0466704_363378 3300042643 Bacteria 6622
84 Ga0466708_030969 3300042652 Bacteria 51477
85 Ga0466705_278397 3300042612 Bacteria 14446
86 Ga0466705_279572 3300042612 Bacteria 5870
87 Ga0466712_187407 3300042614 Bacteria 6142
88 Ga0466711_176014 3300042615 Bacteria 31697
89 Ga0466711_223035 3300042615 Bacteria 5805
90 Ga0466718_076958 3300042617 Bacteria 5916
91 Ga0466718_112761 3300042617 Bacteria 1701
92 Ga0466723_025497 3300042618 Bacteria 1775
93 Ga0466706_239004 3300042599 Bacteria 10762
94 Ga0466707_094169 3300042601 Bacteria 2599
95 Ga0466707_293159 3300042601 Bacteria 2735
96 Ga0466713_093987 3300042602 Bacteria 13299
97 Ga0466716_421483 3300042605 Bacteria 7572
98 Ga0466722_089413 3300042609 Bacteria 4949
99 Ga0466690_077207 3300042590 Unclassified 1336
100 Ga0466690_289902 3300042590 Bacteria 4425
101 Ga0466692_043992 3300042591 Bacteria 6997
102 Ga0466692_107915 3300042591 Bacteria 12436
103 Ga0466691_016173 3300042593 Bacteria 7004
104 Ga0466735_023960 3300042624 Bacteria 2610
105 Ga0466703_058642 3300042636 Unclassified 10733
106 Ga0466727_138384 3300042655 Unclassified 2853
107 Ga0466723_149815 3300042618 Bacteria 17280
108 Ga0466723_251920 3300042618 Bacteria 10899
109 Ga0466723_275897 3300042618 Bacteria 48405
110 Ga0466723_278903 3300042618 Bacteria 5486
111 Ga0466726_311027 3300042619 Bacteria 4857
112 Ga0466728_324562 3300042620 Bacteria 5408
113 Ga0123357_10125567 3300009784 Bacteria 3216
114 Ga0466722_059476 3300042609 Bacteria 18974
115 Ga0466691_100904 3300042593 Bacteria 2649
116 Ga0466709_124551 3300042648 Bacteria 15476
117 Ga0466708_038995 3300042652 Bacteria 14766
118 Ga0466727_031122 3300042655 Unclassified 3070
119 Ga0466727_309132 3300042655 Unclassified 2011
120 Ga0466733_129372 3300042659 Bacteria 7225
121 Ga0466711_463684 3300042615 Bacteria 8627
122 Ga0466726_145622 3300042619 Bacteria 6519
123 Ga0466726_216950 3300042619 Unclassified 1113
124 Ga0466726_265651 3300042619 Bacteria 2291
125 Ga0466726_300296 3300042619 Bacteria 8689
126 Ga0466728_101966 3300042620 Bacteria 40822
127 IMNBL1DRAFT_c0000597 3300000062 Bacteria 29012
128 Ga0466700_457604 3300042600 Bacteria 2159
129 Ga0466719_163458 3300042606 Bacteria 27156
130 Ga0466692_003088 3300042591 Bacteria 16524
131 Ga0466692_171101 3300042591 Bacteria 3940
132 Ga0466692_200599 3300042591 Unclassified 1062
133 Ga0466691_090688 3300042593 Bacteria 1974
134 Ga0466704_139799 3300042643 Unclassified 1949
135 Ga0466709_017970 3300042648 Bacteria 2317
136 Ga0466709_161517 3300042648 Bacteria 4333
137 Ga0466727_137904 3300042655 Unclassified 2263

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042621 Ga0466729_227763 Ga0466729_227763_1529_2386 285
2 3300042590 Ga0466690_016976 Ga0466690_016976_4075_4938 287
3 3300042590 Ga0466690_077207 Ga0466690_077207_447_1310 287
4 3300042618 Ga0466723_149815 Ga0466723_149815_4299_5162 287
5 3300042619 Ga0466726_206714 Ga0466726_206714_190_1053 287
6 3300042643 Ga0466704_139799 Ga0466704_139799_1065_1928 287
7 3300042643 Ga0466704_273998 Ga0466704_273998_22_885 287
8 3300042591 Ga0466692_200599 Ga0466692_200599_169_1035 288
9 3300042617 Ga0466718_112761 Ga0466718_112761_382_1338 297
10 3300042619 Ga0466726_145622 Ga0466726_145622_181_1152 297
11 3300042591 Ga0466692_118660 Ga0466692_118660_314_1282 299
12 3300000062 IMNBL1DRAFT_c0000597 IMNBL1DRAFT_00005977 300
13 3300042590 Ga0466690_283388 Ga0466690_283388_5717_6625 302
14 3300042612 Ga0466705_271200 Ga0466705_271200_4760_5722 302
15 3300042605 Ga0466716_068037 Ga0466716_068037_1059_2009 303
16 3300042599 Ga0466706_007306 Ga0466706_007306_2368_3324 304
17 3300042605 Ga0466716_308675 Ga0466716_308675_4499_5419 306
18 3300042659 Ga0466733_022732 Ga0466733_022732_5545_6498 306
19 3300042593 Ga0466691_120832 Ga0466691_120832_866_1795 309
20 3300042601 Ga0466707_203220 Ga0466707_203220_375_1394 310
21 3300042596 Ga0466696_329025 Ga0466696_329025_2523_3485 311
22 3300042602 Ga0466713_087932 Ga0466713_087932_23025_23963 312
23 3300042648 Ga0466709_124551 Ga0466709_124551_2274_3212 312
24 3300042609 Ga0466722_019497 Ga0466722_019497_3031_3975 314
25 3300042609 Ga0466722_089413 Ga0466722_089413_3915_4859 314
26 3300042643 Ga0466704_135516 Ga0466704_135516_24386_25330 314
27 3300042648 Ga0466709_239318 Ga0466709_239318_1161_2108 315
28 3300042655 Ga0466727_224371 Ga0466727_224371_10715_11743 315
29 3300042590 Ga0466690_289902 Ga0466690_289902_3190_4140 316
30 3300042591 Ga0466692_008402 Ga0466692_008402_3025_4014 316
31 3300042593 Ga0466691_016325 Ga0466691_016325_7846_8796 316
32 3300042593 Ga0466691_067489 Ga0466691_067489_4079_5029 316
33 3300042593 Ga0466691_090688 Ga0466691_090688_719_1669 316
34 3300042593 Ga0466691_149608 Ga0466691_149608_15646_16596 316
35 3300042599 Ga0466706_239004 Ga0466706_239004_9139_10152 316
36 3300042605 Ga0466716_203659 Ga0466716_203659_137_1087 316
37 3300042605 Ga0466716_312354 Ga0466716_312354_1778_2728 316
38 3300042606 Ga0466719_041733 Ga0466719_041733_3302_4252 316
39 3300042612 Ga0466705_083588 Ga0466705_083588_2399_3349 316
40 3300042612 Ga0466705_203390 Ga0466705_203390_2945_3895 316
41 3300042616 Ga0466715_541118 Ga0466715_541118_14740_15690 316
42 3300042618 Ga0466723_161240 Ga0466723_161240_3617_4567 316
43 3300042620 Ga0466728_324562 Ga0466728_324562_1491_2441 316
44 3300042636 Ga0466703_150251 Ga0466703_150251_634_1584 316
45 3300042636 Ga0466703_213291 Ga0466703_213291_4181_5131 316
46 3300042648 Ga0466709_150515 Ga0466709_150515_2909_3859 316
47 3300042652 Ga0466708_038995 Ga0466708_038995_9343_10293 316
48 3300042655 Ga0466727_138384 Ga0466727_138384_415_1365 316
49 3300009784 Ga0123357_10125567 Ga0123357_101255672 317
50 3300042596 Ga0466696_041253 Ga0466696_041253_2023_3003 317
51 3300042605 Ga0466716_103489 Ga0466716_103489_20298_21251 317
52 3300042606 Ga0466719_016516 Ga0466719_016516_7111_8064 317
53 3300042615 Ga0466711_463684 Ga0466711_463684_3697_4650 317
54 3300042615 Ga0466711_476427 Ga0466711_476427_1918_2871 317
55 3300042617 Ga0466718_076958 Ga0466718_076958_2617_3570 317
56 3300042643 Ga0466704_363378 Ga0466704_363378_5544_6497 317
57 3300042652 Ga0466708_030969 Ga0466708_030969_24995_25948 317
58 3300042652 Ga0466708_303006 Ga0466708_303006_509_1462 317
59 3300042590 Ga0466690_030572 Ga0466690_030572_5922_6878 318
60 3300042591 Ga0466692_094517 Ga0466692_094517_139_1095 318
61 3300042591 Ga0466692_171101 Ga0466692_171101_1538_2494 318
62 3300042593 Ga0466691_063397 Ga0466691_063397_2706_3662 318
63 3300042593 Ga0466691_217358 Ga0466691_217358_4456_5412 318
64 3300042596 Ga0466696_403183 Ga0466696_403183_62_1018 318
65 3300042601 Ga0466707_293159 Ga0466707_293159_1322_2278 318
66 3300042612 Ga0466705_278397 Ga0466705_278397_11178_12134 318
67 3300042612 Ga0466705_279572 Ga0466705_279572_553_1509 318
68 3300042614 Ga0466712_187407 Ga0466712_187407_3097_4053 318
69 3300042616 Ga0466715_295077 Ga0466715_295077_4899_5855 318
70 3300042616 Ga0466715_440436 Ga0466715_440436_20750_21706 318
71 3300042618 Ga0466723_278903 Ga0466723_278903_1478_2434 318
72 3300042618 Ga0466723_360356 Ga0466723_360356_3021_3977 318
73 3300042619 Ga0466726_117995 Ga0466726_117995_19_975 318
74 3300042619 Ga0466726_300296 Ga0466726_300296_5229_6185 318
75 3300042624 Ga0466735_010612 Ga0466735_010612_4493_5449 318
76 3300042624 Ga0466735_023960 Ga0466735_023960_569_1525 318
77 3300042636 Ga0466703_058642 Ga0466703_058642_9612_10568 318
78 3300042648 Ga0466709_161517 Ga0466709_161517_238_1194 318
79 3300042652 Ga0466708_085239 Ga0466708_085239_22030_22986 318
80 3300042655 Ga0466727_309132 Ga0466727_309132_714_1670 318
81 3300042659 Ga0466733_129372 Ga0466733_129372_6038_6994 318
82 3300042659 Ga0466733_207889 Ga0466733_207889_1785_2741 318
83 3300042609 Ga0466722_009039 Ga0466722_009039_12052_13044 319
84 3300042619 Ga0466726_177351 Ga0466726_177351_12_971 319
85 3300042593 Ga0466691_100904 Ga0466691_100904_967_1929 320
86 3300042600 Ga0466700_457604 Ga0466700_457604_429_1391 320
87 3300042602 Ga0466713_156709 Ga0466713_156709_1502_2500 320
88 3300042605 Ga0466716_421483 Ga0466716_421483_1377_2339 320
89 3300042606 Ga0466719_224892 Ga0466719_224892_75_1037 320
90 3300042615 Ga0466711_016323 Ga0466711_016323_19365_20327 320
91 3300042618 Ga0466723_025497 Ga0466723_025497_127_1089 320
92 3300042619 Ga0466726_057695 Ga0466726_057695_20_982 320
93 3300042619 Ga0466726_210047 Ga0466726_210047_2292_3275 320
94 3300042619 Ga0466726_265651 Ga0466726_265651_433_1395 320
95 3300042636 Ga0466703_206719 Ga0466703_206719_296_1258 320
96 3300042643 Ga0466704_409051 Ga0466704_409051_4653_5615 320
97 3300042648 Ga0466709_017970 Ga0466709_017970_1324_2286 320
98 3300042652 Ga0466708_077091 Ga0466708_077091_97_1059 320
99 3300042652 Ga0466708_080950 Ga0466708_080950_135_1097 320
100 3300042652 Ga0466708_152751 Ga0466708_152751_3488_4450 320
101 3300042655 Ga0466727_082501 Ga0466727_082501_658_1620 320
102 3300042591 Ga0466692_202113 Ga0466692_202113_357_1322 321
103 3300042619 Ga0466726_311027 Ga0466726_311027_563_1528 321
104 3300042636 Ga0466703_031517 Ga0466703_031517_8655_9635 321
105 3300042609 Ga0466722_059476 Ga0466722_059476_8591_9616 322
106 3300042615 Ga0466711_176014 Ga0466711_176014_22381_23349 322
107 3300042591 Ga0466692_010681 Ga0466692_010681_8604_9575 323
108 3300042591 Ga0466692_043992 Ga0466692_043992_3191_4162 323
109 3300042591 Ga0466692_183837 Ga0466692_183837_2172_3143 323
110 3300042619 Ga0466726_216950 Ga0466726_216950_54_1025 323
111 3300042620 Ga0466728_339243 Ga0466728_339243_4786_5757 323
112 3300042636 Ga0466703_060394 Ga0466703_060394_4713_5684 323
113 3300042593 Ga0466691_053028 Ga0466691_053028_1142_2116 324
114 3300042609 Ga0466722_022089 Ga0466722_022089_7083_8057 324
115 3300042618 Ga0466723_275897 Ga0466723_275897_4825_5799 324
116 iso_pr_bacteria 2781125630 2781266500 324
117 3300042615 Ga0466711_223035 Ga0466711_223035_3767_4744 325
118 3300042618 Ga0466723_074762 Ga0466723_074762_4851_5828 325
119 3300042643 Ga0466704_502947 Ga0466704_502947_214_1191 325
120 3300042606 Ga0466719_277749 Ga0466719_277749_9355_10335 326
121 3300042606 Ga0466719_442352 Ga0466719_442352_2489_3469 326
122 3300042655 Ga0466727_031122 Ga0466727_031122_906_1886 326
123 3300042655 Ga0466727_137904 Ga0466727_137904_939_1919 326
124 3300042591 Ga0466692_107915 Ga0466692_107915_4485_5468 327
125 3300042620 Ga0466728_101966 Ga0466728_101966_23166_24149 327
126 3300042593 Ga0466691_016173 Ga0466691_016173_2567_3553 328
127 3300042601 Ga0466707_094169 Ga0466707_094169_221_1207 328
128 3300042609 Ga0466722_054085 Ga0466722_054085_4536_5522 328
129 3300042609 Ga0466722_197828 Ga0466722_197828_140_1126 328
130 3300042618 Ga0466723_251920 Ga0466723_251920_9465_10451 328
131 3300042591 Ga0466692_003088 Ga0466692_003088_324_1349 330
132 3300042591 Ga0466692_144206 Ga0466692_144206_968_1960 330
133 3300042602 Ga0466713_093987 Ga0466713_093987_4974_5966 330
134 3300042609 Ga0466722_165807 Ga0466722_165807_18114_19106 330
135 3300042606 Ga0466719_163458 Ga0466719_163458_10642_11664 340
136 3300042619 Ga0466726_299586 Ga0466726_299586_9252_10298 340
137 3300042643 Ga0466704_332025 Ga0466704_332025_1305_2348 347
138 3300042619 Ga0466726_465311 Ga0466726_465311_976_2031 351

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF16868 NMT1_3 NMT1-like family 65 348 0.98
PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein 80 223 0.81
PF09084 NMT1 NMT1/THI5 like 88 225 0.8

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
4ddd-assembly1.cif.gz_A Crystal structure of an immunogenic protein from ehrlichia chaffeensis 0.848 61 351
5djg-assembly1.cif.gz_A Structure of M. tuberculosis CysQ, a PAP phosphatase with PAP, Mg, and Li bound 0.822 62 117
1us5-assembly1.cif.gz_A PUTATIVE GLUR0 LIGAND BINDING CORE WITH L-GLUTAMATE 0.798 57 350
5djh-assembly1.cif.gz_A Structure of M. tuberculosis CysQ, a PAP phosphatase with AMP, PO4, and 3Mg bound 0.767 62 117
5dji-assembly1.cif.gz_A Structure of M. tuberculosis CysQ, a PAP phosphatase with AMP, PO4, and 2Mg bound 0.765 62 117
IDDescriptionScoreStartEndSuperfamily
1us4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9471 148 284 3.40.190.10
4dddA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9312 148 283 3.40.190.10
1us4A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9047 60 351 3.40.190.10
4dddA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8907 61 351 3.40.190.10
3k2dB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8349 63 148 3.40.190.10
IDDescriptionScoreStartEndGO Terms
AF-X1W1P1-F1-model_v4 Uncharacterized/unreviewed 0.9438 146 285
AF-A0A832GDZ1-F1-model_v4 Uncharacterized/unreviewed 0.9346 114 351
AF-A0A7W2U3R3-F1-model_v4 Uncharacterized/unreviewed 0.931 61 350
AF-A0A139CWP3-F1-model_v4 Uncharacterized/unreviewed 0.9296 78 347

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.74 0.81 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.