Protein Family IF08340

Metagenome Isolate
219 Members
71 Samples
204 Scaffolds
253.35 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_398105|Ga0466726_398105_10299_11138
Length
279 aa
Sequence
MNNGTRQPKAVIEKEELLTLFTKIRQGEITPEEALLRVQTAPFEDLGYAKIDLHRGARQGVSEVVYGQHKTPGQILGIVSAMRGKGLSNILLTRLSDAAASYLTANGIDLEYHPIPRLGVVCRASTDASVDAPYGSIVVASAGTSDMAVCEEAALTAELFGSRVTRLYDVGVAGLHRLLARLDVLSAARVVIAVAGMEGALASVIGGLVSCPVIAVPTSVGYGANFAGLSALLSMLNSCASGVAVVNIDNGFGAGYIANVINKIRSAQDGGADPSEDQS

📊 Sample Types

Isolate 6.8%
Metagenome 93.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.6%
Unclassified 21.7%
Kalotermitidae 20.3%
Termopsidae 5.8%
Rhinotermitidae 2.9%
Passalidae 2.9%
Hodotermitidae 1.4%
Elmidae 1.4%
Culicidae 1.4%
Blattidae 1.4%

🌳 Taxonomy

Archaea 2
Bacteria 197
Eukaryota 0
Viruses 0
Unclassified 20

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2740892545 Fibrobacteria bacterium GUT31 IN01_31 Isolate Unclassified
2 2820391468 Unclassified Firmicutes Nc150P3bin1 Isolate Unclassified
3 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
4 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
5 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
6 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
7 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
8 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
9 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
10 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
11 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
12 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
13 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
14 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
15 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
16 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
17 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
18 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
19 2778260937 Unclassified Fibrobacteres Co191P3bin40 Isolate Unclassified
20 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
21 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
22 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
23 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
24 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
25 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
26 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
27 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
28 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
29 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
30 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
31 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
32 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
33 2778260939 Unclassified Fibrobacteres Co191P4bin13 Isolate Unclassified
34 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
35 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
36 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
37 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
38 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
39 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
40 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
41 2820719201 Unclassified Fibrobacteres Lab288P3bin119 Isolate Unclassified
42 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
43 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
44 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
45 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
46 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
47 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
48 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
49 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
50 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
51 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
52 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
53 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
54 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
55 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
56 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
57 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
58 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
59 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
60 2778260941 Unclassified Fibrobacteres Th196P3bin8 Isolate Unclassified
61 2820344559 Unclassified Firmicutes Nt197P3bin63 Isolate Unclassified
62 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
63 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
64 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
65 2773857779 Unclassified Fibrobacteres Co191P1bin69 Isolate Unclassified
66 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
67 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
68 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
69 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
70 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
71 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_162461 3300042614 Bacteria 25933
2 Ga0466715_322807 3300042616 Bacteria 3312
3 Ga0466718_018787 3300042617 Unclassified 3343
4 Ga0466718_161252 3300042617 Bacteria 1309
5 Ga0466726_217236 3300042619 Bacteria 220873
6 Ga0123355_10385206 3300009826 Bacteria 1823
7 Ga0123353_10003516 3300010167 Bacteria 19821
8 Ga0466707_023773 3300042601 Bacteria 3209
9 Ga0466702_352630 3300042635 Bacteria 1902
10 Ga0466727_084148 3300042655 Bacteria 121095
11 Ga0466727_090836 3300042655 Bacteria 1493
12 Ga0466727_148553 3300042655 Bacteria 1697
13 Ga0466727_150924 3300042655 Bacteria 116830
14 IMNBL1DRAFT_c0016018 3300000062 Unclassified 3226
15 JGI24698J34947_10046231 3300002449 Bacteria 2216
16 JGI24702J35022_10004182 3300002462 Bacteria 8618
17 Ga0068305_10000874 3300005083 Bacteria 29431
18 Ga0072941_1004046 3300005201 Bacteria 45352
19 Ga0072941_1067385 3300005201 Bacteria 15269
20 Ga0072941_1249226 3300005201 Bacteria 1205
21 Ga0466691_225685 3300042593 Bacteria 109994
22 Ga0466712_009128 3300042614 Bacteria 18500
23 Ga0466712_040275 3300042614 Bacteria 8694
24 Ga0466712_207976 3300042614 Bacteria 10538
25 Ga0466715_021845 3300042616 Bacteria 32348
26 Ga0466715_117997 3300042616 Unclassified 13866
27 Ga0466715_388582 3300042616 Bacteria 18317
28 Ga0466723_313926 3300042618 Bacteria 15000
29 Ga0466726_249471 3300042619 Bacteria 2325
30 Ga0466726_285334 3300042619 Bacteria 3989
31 Ga0466729_061040 3300042621 Bacteria 3951
32 Ga0123355_10001768 3300009826 Bacteria 30256
33 Ga0123354_10207559 3300010882 Bacteria 2129
34 Ga0466706_218462 3300042599 Bacteria 2568
35 Ga0466707_209080 3300042601 Bacteria 9297
36 Ga0466716_312933 3300042605 Bacteria 15166
37 Ga0466719_062453 3300042606 Bacteria 18088
38 Ga0466719_126888 3300042606 Unclassified 19991
39 Ga0466720_125154 3300042607 Bacteria 4297
40 Ga0466735_205874 3300042624 Bacteria 4548
41 Ga0466702_122522 3300042635 Unclassified 2499
42 JGI24698J34947_10000550 3300002449 Bacteria 17789
43 Ga0123357_10002388 3300009784 Bacteria 20922
44 Ga0466693_000689 3300042592 Bacteria 5196
45 Ga0466691_094025 3300042593 Bacteria 4432
46 Ga0466710_021228 3300042613 Bacteria 41506
47 Ga0466712_102662 3300042614 Bacteria 1192
48 Ga0466723_075284 3300042618 Bacteria 10946
49 Ga0466726_344866 3300042619 Bacteria 3111
50 Ga0466728_105509 3300042620 Bacteria 43729
51 Ga0123357_10460927 3300009784 Bacteria 1093
52 Ga0123355_10023396 3300009826 Bacteria 9923
53 Ga0123356_10009942 3300010049 Bacteria 9366
54 Ga0123353_10248647 3300010167 Bacteria 2756
55 Ga0123353_10370031 3300010167 Bacteria 2149
56 Ga0123353_10582062 3300010167 Bacteria 1605
57 Ga0466713_011752 3300042602 Bacteria 44620
58 Ga0466713_056585 3300042602 Bacteria 30523
59 Ga0466716_209896 3300042605 Bacteria 12981
60 Ga0466719_354280 3300042606 Bacteria 3354
61 Ga0466722_184615 3300042609 Bacteria 8069
62 Ga0466702_030254 3300042635 Bacteria 4625
63 Ga0466703_250320 3300042636 Bacteria 592480
64 Ga0466704_123592 3300042643 Bacteria 55096
65 JGI24698J34947_10000111 3300002449 Bacteria 28366
66 JGI24695J34938_10094737 3300002450 Bacteria 1223
67 Ga0072941_1013877 3300005201 Unclassified 24626
68 Ga0072941_1016260 3300005201 Bacteria 26281
69 Ga0264413_119278 3300024493 Unclassified 2452
70 Ga0466690_052731 3300042590 Bacteria 14113
71 Ga0466693_078209 3300042592 Bacteria 15560
72 Ga0466694_032721 3300042594 Bacteria 3030
73 Ga0466696_170363 3300042596 Bacteria 3656
74 Ga0466711_206477 3300042615 Bacteria 1020
75 Ga0466715_061157 3300042616 Bacteria 14827
76 Ga0466715_240730 3300042616 Bacteria 70518
77 Ga0466715_627388 3300042616 Bacteria 115089
78 Ga0466718_012244 3300042617 Bacteria 10402
79 Ga0466718_164519 3300042617 Bacteria 4496
80 Ga0466723_219380 3300042618 Bacteria 16058
81 Ga0466726_040454 3300042619 Bacteria 2278
82 Ga0123353_10058621 3300010167 Bacteria 6170
83 Ga0123353_10497919 3300010167 Bacteria 1776
84 Ga0123353_11122088 3300010167 Bacteria 1041
85 Ga0466713_060358 3300042602 Bacteria 76386
86 Ga0466722_248021 3300042609 Bacteria 24248
87 Ga0466731_226095 3300042622 Bacteria 14920
88 Ga0466703_297849 3300042636 Bacteria 43169
89 Ga0466704_189815 3300042643 Bacteria 16259
90 Ga0466704_596461 3300042643 Bacteria 93141
91 Ga0466725_006313 3300042654 Bacteria 4265
92 2227596853 2225789004 Bacteria 12648
93 JGI24698J34947_10019452 3300002449 Bacteria 3661
94 JGI24695J34938_10015014 3300002450 Bacteria 3990
95 JGI24702J35022_10333945 3300002462 Bacteria 902
96 Ga0072940_1021210 3300005200 Bacteria 6049
97 Ga0415639_008150 3300038395 Bacteria 32743
98 Ga0466690_001780 3300042590 Bacteria 34391
99 Ga0466691_064850 3300042593 Bacteria 16118
100 Ga0466691_213616 3300042593 Bacteria 1373
101 Ga0466694_057187 3300042594 Bacteria 39446
102 Ga0466694_149164 3300042594 Bacteria 23932
103 Ga0466694_173402 3300042594 Bacteria 3699
104 Ga0466711_006581 3300042615 Bacteria 37124
105 Ga0466711_139323 3300042615 Bacteria 40126
106 Ga0466715_276530 3300042616 Bacteria 26521
107 Ga0466718_124840 3300042617 Bacteria 2410
108 Ga0466723_322192 3300042618 Bacteria 41479
109 Ga0466726_118683 3300042619 Unclassified 3589
110 Ga0466726_166854 3300042619 Bacteria 14683
111 Ga0466726_309603 3300042619 Archaea 7250
112 Ga0466726_444494 3300042619 Unclassified 3732
113 Ga0466728_341607 3300042620 Bacteria 1664
114 Ga0466729_101464 3300042621 Unclassified 2695
115 Ga0123355_10015648 3300009826 Bacteria 11927
116 Ga0123355_10033503 3300009826 Bacteria 8344
117 Ga0123356_10329109 3300010049 Bacteria 1644
118 Ga0123353_10434890 3300010167 Archaea 1938
119 Ga0123353_10543378 3300010167 Bacteria 1678
120 Ga0123353_10601931 3300010167 Bacteria 1571
121 Ga0123353_10926034 3300010167 Bacteria 1183
122 Ga0466706_004548 3300042599 Bacteria 42399
123 Ga0466706_201378 3300042599 Bacteria 153801
124 Ga0466707_102983 3300042601 Bacteria 37658
125 Ga0466707_343493 3300042601 Bacteria 38851
126 Ga0466714_039435 3300042603 Bacteria 5561
127 Ga0466717_103477 3300042604 Bacteria 6637
128 Ga0466719_373532 3300042606 Bacteria 11756
129 Ga0466720_238637 3300042607 Bacteria 4531
130 Ga0466698_450067 3300042610 Bacteria 1714
131 Ga0466704_263964 3300042643 Bacteria 3235
132 Ga0466727_041865 3300042655 Bacteria 123201
133 JGI24695J34938_10001046 3300002450 Unclassified 25090
134 JGI24700J35501_10929706 3300002508 Bacteria 9896
135 JGI24696J40584_12959334 3300002834 Bacteria 4997
136 Ga0068305_10000886 3300005083 Bacteria 103801
137 Ga0072940_1001247 3300005200 Bacteria 3030
138 Ga0072940_1018102 3300005200 Bacteria 2140
139 Ga0466690_055751 3300042590 Bacteria 148091
140 Ga0466696_058170 3300042596 Unclassified 39011
141 Ga0466696_271787 3300042596 Bacteria 1874
142 Ga0466699_007048 3300042597 Bacteria 2460
143 Ga0466712_149563 3300042614 Bacteria 12473
144 Ga0466715_346322 3300042616 Bacteria 84028
145 Ga0466715_614770 3300042616 Bacteria 11428
146 Ga0466718_013271 3300042617 Bacteria 1989
147 Ga0466718_037555 3300042617 Bacteria 1040
148 Ga0466723_173627 3300042618 Bacteria 6527
149 Ga0466728_306322 3300042620 Bacteria 70422
150 Ga0123353_10190159 3300010167 Bacteria 3241
151 Ga0123353_10195343 3300010167 Bacteria 3190
152 Ga0123354_10144877 3300010882 Bacteria 2914
153 Ga0466706_057588 3300042599 Bacteria 4063
154 Ga0466707_417739 3300042601 Bacteria 9462
155 Ga0466716_289779 3300042605 Bacteria 20915
156 Ga0466719_007077 3300042606 Unclassified 15203
157 Ga0466722_147052 3300042609 Bacteria 82065
158 Ga0466702_441639 3300042635 Bacteria 3351
159 Ga0466704_415603 3300042643 Bacteria 3511
160 JGI24698J34947_10000049 3300002449 Bacteria 34934
161 Ga0068302_10004326 3300005071 Unclassified 9480
162 Ga0466705_149033 3300042612 Bacteria 15839
163 Ga0466705_263529 3300042612 Bacteria 1724
164 Ga0466732_017156 3300042656 Bacteria 1917
165 Ga0466690_053851 3300042590 Bacteria 4036
166 Ga0466690_215614 3300042590 Unclassified 8016
167 Ga0466690_338573 3300042590 Unclassified 4756
168 Ga0466691_213246 3300042593 Bacteria 5825
169 Ga0466694_229388 3300042594 Bacteria 1585
170 Ga0466699_171164 3300042597 Bacteria 22865
171 Ga0466712_045449 3300042614 Bacteria 2509
172 Ga0466711_261053 3300042615 Bacteria 39528
173 Ga0466715_100290 3300042616 Bacteria 4019
174 Ga0466718_018562 3300042617 Bacteria 22359
175 Ga0466723_141836 3300042618 Bacteria 6196
176 Ga0466726_398105 3300042619 Bacteria 17744
177 Ga0123354_10179045 3300010882 Bacteria 2429
178 Ga0466707_079338 3300042601 Bacteria 13659
179 Ga0466719_554262 3300042606 Bacteria 2661
180 Ga0466729_301371 3300042621 Bacteria 6743
181 Ga0466702_061851 3300042635 Bacteria 3699
182 Ga0466709_209789 3300042648 Unclassified 19481
183 JGI24695J34938_10005301 3300002450 Bacteria 8090
184 JGI24695J34938_10006850 3300002450 Bacteria 6765
185 Ga0068302_10011111 3300005071 Bacteria 5040
186 Ga0068305_10000004 3300005083 Bacteria 52322
187 Ga0068305_10000424 3300005083 Bacteria 48657
188 Ga0072941_1016449 3300005201 Bacteria 37637
189 Ga0466705_109930 3300042612 Unclassified 7496
190 Ga0466711_261625 3300042615 Bacteria 6104
191 Ga0466715_125251 3300042616 Bacteria 41475
192 Ga0466723_305554 3300042618 Bacteria 2037
193 Ga0123355_10014491 3300009826 Bacteria 12335
194 Ga0123353_10018049 3300010167 Bacteria 10410
195 Ga0123353_10084327 3300010167 Bacteria 5115
196 Ga0123353_10230644 3300010167 Bacteria 2887
197 Ga0160471_102044 3300012812 Bacteria 3540
198 Ga0466719_524336 3300042606 Bacteria 382683
199 Ga0466704_072859 3300042643 Bacteria 3504
200 Ga0466704_230819 3300042643 Unclassified 15790
201 Ga0466708_065015 3300042652 Bacteria 2799
202 AustNasuHG_c1005551 3300000089 Bacteria 4508
203 JGI24698J34947_10000842 3300002449 Unclassified 15401
204 Ga0072940_1061205 3300005200 Bacteria 1508

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010882 Ga0123354_10179045 Ga0123354_101790452 224
2 3300042601 Ga0466707_417739 Ga0466707_417739_8472_9152 226
3 3300010167 Ga0123353_10926034 Ga0123353_109260341 227
4 3300024493 Ga0264413_119278 Ga0264413_1192782 230
5 3300042606 Ga0466719_007077 Ga0466719_007077_8795_9553 231
6 3300042609 Ga0466722_147052 Ga0466722_147052_31773_32555 232
7 3300042616 Ga0466715_117997 Ga0466715_117997_5830_6588 235
8 3300042648 Ga0466709_209789 Ga0466709_209789_7864_8622 235
9 3300042618 Ga0466723_075284 Ga0466723_075284_3389_4162 238
10 3300042616 Ga0466715_388582 Ga0466715_388582_17320_18075 239
11 3300042616 Ga0466715_614770 Ga0466715_614770_5755_6474 239
12 3300042601 Ga0466707_102983 Ga0466707_102983_20308_21066 241
13 3300005201 Ga0072941_1016260 Ga0072941_10162606 242
14 3300042652 Ga0466708_065015 Ga0466708_065015_1772_2530 242
15 3300042601 Ga0466707_209080 Ga0466707_209080_5683_6414 243
16 3300042610 Ga0466698_450067 Ga0466698_450067_47_781 244
17 iso_pr_bacteria 2773857779 2774479436 247
18 3300002450 JGI24695J34938_10094737 JGI24695J34938_100947372 248
19 3300009826 Ga0123355_10385206 Ga0123355_103852062 248
20 3300042592 Ga0466693_078209 Ga0466693_078209_13405_14151 248
21 3300042593 Ga0466691_213616 Ga0466691_213616_115_888 248
22 3300042594 Ga0466694_057187 Ga0466694_057187_16673_17419 248
23 3300042597 Ga0466699_007048 Ga0466699_007048_1186_1932 248
24 3300042616 Ga0466715_346322 Ga0466715_346322_36881_37627 248
25 3300042635 Ga0466702_061851 Ga0466702_061851_2688_3434 248
26 3300042635 Ga0466702_441639 Ga0466702_441639_200_946 248
27 iso_pr_bacteria 2529293168 2531456063 248
28 iso_pr_bacteria 2781125639 2781286125 248
29 iso_pr_bacteria 2781125655 2781319004 248
30 iso_pr_bacteria 2820391468 2820391926 248
31 iso_pr_bacteria 2940373808 2940376598 248
32 3300002450 JGI24695J34938_10005301 JGI24695J34938_100053017 249
33 3300005201 Ga0072941_1249226 Ga0072941_12492262 249
34 3300009826 Ga0123355_10015648 Ga0123355_100156482 249
35 3300010167 Ga0123353_10018049 Ga0123353_1001804912 249
36 3300010167 Ga0123353_10084327 Ga0123353_100843271 249
37 3300010167 Ga0123353_10230644 Ga0123353_102306442 249
38 3300010167 Ga0123353_10497919 Ga0123353_104979192 249
39 3300010167 Ga0123353_10543378 Ga0123353_105433782 249
40 3300010167 Ga0123353_10582062 Ga0123353_105820622 249
41 3300010167 Ga0123353_11122088 Ga0123353_111220881 249
42 3300042594 Ga0466694_173402 Ga0466694_173402_1339_2088 249
43 3300042607 Ga0466720_125154 Ga0466720_125154_3320_4069 249
44 2225789004 2227596853 2228160046 250
45 3300010882 Ga0123354_10207559 Ga0123354_102075593 250
46 3300042592 Ga0466693_000689 Ga0466693_000689_1033_1785 250
47 3300042594 Ga0466694_032721 Ga0466694_032721_306_1058 250
48 3300042614 Ga0466712_045449 Ga0466712_045449_1613_2365 250
49 3300042617 Ga0466718_164519 Ga0466718_164519_1946_2698 250
50 3300042635 Ga0466702_030254 Ga0466702_030254_980_1732 250
51 iso_pr_bacteria 2740892545 2743906931 250
52 3300000062 IMNBL1DRAFT_c0016018 IMNBL1DRAFT_00160182 251
53 3300002449 JGI24698J34947_10000111 JGI24698J34947_100001113 251
54 3300002449 JGI24698J34947_10000550 JGI24698J34947_1000055014 251
55 3300002450 JGI24695J34938_10006850 JGI24695J34938_100068502 251
56 3300002450 JGI24695J34938_10015014 JGI24695J34938_100150142 251
57 3300005201 Ga0072941_1013877 Ga0072941_101387726 251
58 3300005201 Ga0072941_1016449 Ga0072941_10164498 251
59 3300005201 Ga0072941_1067385 Ga0072941_106738515 251
60 3300010167 Ga0123353_10190159 Ga0123353_101901593 251
61 3300010167 Ga0123353_10195343 Ga0123353_101953432 251
62 3300010882 Ga0123354_10144877 Ga0123354_101448772 251
63 3300042601 Ga0466707_023773 Ga0466707_023773_243_998 251
64 3300042602 Ga0466713_011752 Ga0466713_011752_17683_18438 251
65 3300042607 Ga0466720_238637 Ga0466720_238637_699_1454 251
66 3300042609 Ga0466722_184615 Ga0466722_184615_2555_3310 251
67 3300042614 Ga0466712_040275 Ga0466712_040275_3061_3816 251
68 3300042614 Ga0466712_162461 Ga0466712_162461_20668_21423 251
69 3300042614 Ga0466712_207976 Ga0466712_207976_7119_7874 251
70 3300042617 Ga0466718_037555 Ga0466718_037555_258_1013 251
71 3300042617 Ga0466718_161252 Ga0466718_161252_526_1281 251
72 3300042619 Ga0466726_040454 Ga0466726_040454_525_1280 251
73 3300000089 AustNasuHG_c1005551 AustNasuHG_10055516 252
74 3300002449 JGI24698J34947_10000049 JGI24698J34947_1000004920 252
75 3300002449 JGI24698J34947_10000842 JGI24698J34947_1000084214 252
76 3300002449 JGI24698J34947_10019452 JGI24698J34947_100194525 252
77 3300005200 Ga0072940_1018102 Ga0072940_10181022 252
78 3300005200 Ga0072940_1061205 Ga0072940_10612053 252
79 3300042593 Ga0466691_225685 Ga0466691_225685_22698_23456 252
80 3300042609 Ga0466722_248021 Ga0466722_248021_9215_9973 252
81 3300042613 Ga0466710_021228 Ga0466710_021228_2492_3250 252
82 3300042615 Ga0466711_206477 Ga0466711_206477_169_927 252
83 3300042616 Ga0466715_021845 Ga0466715_021845_27314_28072 252
84 3300042616 Ga0466715_276530 Ga0466715_276530_23493_24251 252
85 3300042616 Ga0466715_322807 Ga0466715_322807_1365_2123 252
86 3300042617 Ga0466718_018562 Ga0466718_018562_19056_19814 252
87 3300042620 Ga0466728_306322 Ga0466728_306322_14019_14777 252
88 3300042622 Ga0466731_226095 Ga0466731_226095_5230_5988 252
89 3300042643 Ga0466704_123592 Ga0466704_123592_14056_14814 252
90 3300042654 Ga0466725_006313 Ga0466725_006313_141_899 252
91 iso_pr_bacteria 2778260941 2778359651 252
92 3300002462 JGI24702J35022_10333945 JGI24702J35022_103339451 253
93 3300005200 Ga0072940_1001247 Ga0072940_10012473 253
94 3300005200 Ga0072940_1021210 Ga0072940_10212106 253
95 3300005201 Ga0072941_1004046 Ga0072941_100404620 253
96 3300009826 Ga0123355_10001768 Ga0123355_100017689 253
97 3300010049 Ga0123356_10009942 Ga0123356_100099427 253
98 3300010049 Ga0123356_10329109 Ga0123356_103291092 253
99 3300010167 Ga0123353_10248647 Ga0123353_102486473 253
100 3300010167 Ga0123353_10370031 Ga0123353_103700312 253
101 3300042594 Ga0466694_149164 Ga0466694_149164_6620_7381 253
102 3300042596 Ga0466696_170363 Ga0466696_170363_1305_2066 253
103 3300042603 Ga0466714_039435 Ga0466714_039435_3968_4729 253
104 3300042605 Ga0466716_209896 Ga0466716_209896_7681_8442 253
105 3300042606 Ga0466719_373532 Ga0466719_373532_467_1228 253
106 3300042612 Ga0466705_149033 Ga0466705_149033_12265_13026 253
107 3300042616 Ga0466715_125251 Ga0466715_125251_19013_19774 253
108 3300042618 Ga0466723_219380 Ga0466723_219380_12880_13641 253
109 3300042624 Ga0466735_205874 Ga0466735_205874_1841_2602 253
110 3300042643 Ga0466704_072859 Ga0466704_072859_2498_3259 253
111 3300042655 Ga0466727_084148 Ga0466727_084148_14827_15588 253
112 3300042655 Ga0466727_150924 Ga0466727_150924_48489_49250 253
113 iso_pr_bacteria 2778260937 2778347890 253
114 iso_pr_bacteria 2778260939 2778352392 253
115 iso_pr_bacteria 2820344559 2820345107 253
116 3300002450 JGI24695J34938_10001046 JGI24695J34938_1000104626 254
117 3300002834 JGI24696J40584_12959334 JGI24696J40584_129593346 254
118 3300010167 Ga0123353_10434890 Ga0123353_104348902 254
119 3300042614 Ga0466712_149563 Ga0466712_149563_22_786 254
120 3300042617 Ga0466718_012244 Ga0466718_012244_8792_9556 254
121 3300042617 Ga0466718_013271 Ga0466718_013271_643_1407 254
122 3300042619 Ga0466726_118683 Ga0466726_118683_514_1278 254
123 3300009784 Ga0123357_10002388 Ga0123357_100023888 255
124 3300010167 Ga0123353_10058621 Ga0123353_100586215 255
125 3300042594 Ga0466694_229388 Ga0466694_229388_381_1148 255
126 3300042597 Ga0466699_171164 Ga0466699_171164_3544_4311 255
127 3300042619 Ga0466726_217236 Ga0466726_217236_177961_178728 255
128 3300042619 Ga0466726_444494 Ga0466726_444494_654_1421 255
129 3300042635 Ga0466702_122522 Ga0466702_122522_234_1001 255
130 3300005071 Ga0068302_10004326 Ga0068302_100043269 256
131 3300042599 Ga0466706_201378 Ga0466706_201378_28792_29562 256
132 3300042602 Ga0466713_056585 Ga0466713_056585_25646_26416 256
133 3300042604 Ga0466717_103477 Ga0466717_103477_3839_4609 256
134 3300042606 Ga0466719_354280 Ga0466719_354280_43_813 256
135 3300042606 Ga0466719_554262 Ga0466719_554262_529_1299 256
136 3300042612 Ga0466705_109930 Ga0466705_109930_3547_4317 256
137 3300042619 Ga0466726_344866 Ga0466726_344866_1052_1822 256
138 3300042620 Ga0466728_341607 Ga0466728_341607_380_1150 256
139 3300042621 Ga0466729_301371 Ga0466729_301371_2721_3491 256
140 3300042643 Ga0466704_263964 Ga0466704_263964_2196_2966 256
141 3300042643 Ga0466704_415603 Ga0466704_415603_2557_3327 256
142 3300042655 Ga0466727_090836 Ga0466727_090836_257_1027 256
143 iso_pr_bacteria 2864816158 2864816465 256
144 3300005071 Ga0068302_10011111 Ga0068302_100111113 257
145 3300005083 Ga0068305_10000874 Ga0068305_100008745 257
146 3300012812 Ga0160471_102044 Ga0160471_1020442 257
147 3300042590 Ga0466690_052731 Ga0466690_052731_6412_7185 257
148 3300042590 Ga0466690_053851 Ga0466690_053851_1732_2505 257
149 3300042590 Ga0466690_055751 Ga0466690_055751_28212_28985 257
150 3300042590 Ga0466690_215614 Ga0466690_215614_2478_3251 257
151 3300042590 Ga0466690_338573 Ga0466690_338573_2870_3643 257
152 3300042593 Ga0466691_064850 Ga0466691_064850_9040_9813 257
153 3300042596 Ga0466696_058170 Ga0466696_058170_6064_6837 257
154 3300042599 Ga0466706_218462 Ga0466706_218462_142_915 257
155 3300042601 Ga0466707_079338 Ga0466707_079338_1810_2583 257
156 3300042601 Ga0466707_343493 Ga0466707_343493_19346_20119 257
157 3300042605 Ga0466716_289779 Ga0466716_289779_2442_3215 257
158 3300042605 Ga0466716_312933 Ga0466716_312933_2447_3220 257
159 3300042606 Ga0466719_126888 Ga0466719_126888_4810_5583 257
160 3300042615 Ga0466711_006581 Ga0466711_006581_32145_32918 257
161 3300042615 Ga0466711_139323 Ga0466711_139323_33472_34245 257
162 3300042615 Ga0466711_261053 Ga0466711_261053_27478_28251 257
163 3300042616 Ga0466715_100290 Ga0466715_100290_2021_2794 257
164 3300042616 Ga0466715_240730 Ga0466715_240730_30870_31643 257
165 3300042618 Ga0466723_141836 Ga0466723_141836_568_1341 257
166 3300042618 Ga0466723_313926 Ga0466723_313926_12087_12860 257
167 3300042618 Ga0466723_322192 Ga0466723_322192_36599_37372 257
168 3300042619 Ga0466726_166854 Ga0466726_166854_4363_5136 257
169 3300042619 Ga0466726_249471 Ga0466726_249471_1004_1777 257
170 3300042619 Ga0466726_309603 Ga0466726_309603_3235_4008 257
171 3300042620 Ga0466728_105509 Ga0466728_105509_22244_23017 257
172 3300042621 Ga0466729_061040 Ga0466729_061040_3104_3877 257
173 3300042621 Ga0466729_101464 Ga0466729_101464_1848_2621 257
174 3300042635 Ga0466702_352630 Ga0466702_352630_721_1494 257
175 3300042636 Ga0466703_297849 Ga0466703_297849_36421_37194 257
176 3300042643 Ga0466704_230819 Ga0466704_230819_12486_13259 257
177 3300042655 Ga0466727_041865 Ga0466727_041865_41207_41980 257
178 iso_pr_bacteria 2819994798 2819996074 257
179 3300002462 JGI24702J35022_10004182 JGI24702J35022_100041824 258
180 3300002508 JGI24700J35501_10929706 JGI24700J35501_109297066 258
181 3300005083 Ga0068305_10000004 Ga0068305_1000000436 258
182 3300005083 Ga0068305_10000424 Ga0068305_100004247 258
183 3300009784 Ga0123357_10460927 Ga0123357_104609271 258
184 3300042599 Ga0466706_004548 Ga0466706_004548_1694_2470 258
185 3300042614 Ga0466712_009128 Ga0466712_009128_10547_11323 258
186 3300042616 Ga0466715_061157 Ga0466715_061157_8225_9001 258
187 3300042617 Ga0466718_124840 Ga0466718_124840_235_1011 258
188 iso_pr_bacteria 2781125690 2781428604 258
189 3300002449 JGI24698J34947_10046231 JGI24698J34947_100462313 259
190 3300010167 Ga0123353_10601931 Ga0123353_106019311 259
191 3300038395 Ga0415639_008150 Ga0415639_008150_11149_11928 259
192 3300042606 Ga0466719_524336 Ga0466719_524336_127913_128692 259
193 3300042593 Ga0466691_094025 Ga0466691_094025_3240_4022 260
194 3300042616 Ga0466715_627388 Ga0466715_627388_78024_78806 260
195 3300042636 Ga0466703_250320 Ga0466703_250320_266560_267342 260
196 3300009826 Ga0123355_10023396 Ga0123355_1002339612 261
197 3300042593 Ga0466691_213246 Ga0466691_213246_536_1321 261
198 3300042602 Ga0466713_060358 Ga0466713_060358_69980_70765 261
199 3300042606 Ga0466719_062453 Ga0466719_062453_1681_2466 261
200 3300042612 Ga0466705_263529 Ga0466705_263529_834_1619 261
201 3300042618 Ga0466723_173627 Ga0466723_173627_2686_3471 261
202 3300042618 Ga0466723_305554 Ga0466723_305554_670_1455 261
203 3300042643 Ga0466704_596461 Ga0466704_596461_70569_71354 261
204 3300042655 Ga0466727_148553 Ga0466727_148553_672_1457 261
205 iso_pr_bacteria 2820719201 2820720616 261
206 3300005083 Ga0068305_10000886 Ga0068305_1000088665 262
207 3300009826 Ga0123355_10033503 Ga0123355_1003350310 262
208 3300010167 Ga0123353_10003516 Ga0123353_1000351611 262
209 3300042590 Ga0466690_001780 Ga0466690_001780_21673_22461 262
210 3300042596 Ga0466696_271787 Ga0466696_271787_28_816 262
211 3300042614 Ga0466712_102662 Ga0466712_102662_217_1005 262
212 3300042619 Ga0466726_285334 Ga0466726_285334_2835_3623 262
213 3300042643 Ga0466704_189815 Ga0466704_189815_4880_5668 262
214 3300009826 Ga0123355_10014491 Ga0123355_100144912 263
215 3300042599 Ga0466706_057588 Ga0466706_057588_1084_1878 264
216 3300042656 Ga0466732_017156 Ga0466732_017156_972_1769 265
217 3300042617 Ga0466718_018787 Ga0466718_018787_2437_3276 279
218 3300042619 Ga0466726_398105 Ga0466726_398105_10299_11138 279
219 3300042615 Ga0466711_261625 Ga0466711_261625_4252_5106 284

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00731 AIRC AIR carboxylase 137 264 0.86

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00731 GO:0006189 'de novo' IMP biosynthetic process BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.81 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.