Protein Family IF08319

Metagenome Isolate
118 Members
35 Samples
114 Scaffolds
253.31 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_356013|Ga0466726_356013_2970_3860
Length
296 aa
Sequence
MSSMAARGSLGKKMREKMSRFASEAQIAAHELLDVPLSKERGEILFSIRNISKVFRSGGGEITSALAGIDLDIYEGECLLIAGSNGSGKTLLMKIIAGLTTPSGGEVLFRGKALEQCGKTLRGELGLVFQDADAQFVGETVAEDIAFGPRNLGLSREEAARKVEEALAATGLAEKRASPPRQLSGGEKRRLAVAGVIATGCNTVIFDEPFVSLDWPGIVQVLEIVRDLKQSGRTVILLTHELEKVLAFADRLVILHRGQIRDDGKPAEVLSRLKAEYGVRNPLHGYTSVESCSWLV

📊 Sample Types

Isolate 3.4%
Metagenome 96.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 40.0%
Termitidae 28.6%
Unclassified 11.4%
Rhinotermitidae 8.6%
Termopsidae 8.6%
Hodotermitidae 2.9%

🌳 Taxonomy

Archaea 1
Bacteria 107
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
3 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
4 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
5 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
6 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
7 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
14 2820641689 Unclassified Firmicutes Cu122P5bin5 Isolate Unclassified
15 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
16 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
19 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
22 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
23 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
24 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
25 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
26 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
27 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
28 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
29 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
30 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
31 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
32 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
33 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
34 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
35 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466709_256423 3300042648 Unclassified 3677
2 Ga0466708_260186 3300042652 Bacteria 4322
3 Ga0466728_012064 3300042620 Bacteria 2602
4 Ga0466716_076206 3300042605 Bacteria 28153
5 Ga0456237_0004774 3300041968 Bacteria 2171
6 Ga0466692_151515 3300042591 Bacteria 25092
7 Ga0466692_193197 3300042591 Bacteria 8146
8 Ga0123355_10044202 3300009826 Bacteria 7249
9 JGI24698J34947_10066884 3300002449 Bacteria 1747
10 Ga0466709_416174 3300042648 Bacteria 5208
11 Ga0466727_205366 3300042655 Bacteria 1456
12 Ga0466711_308647 3300042615 Bacteria 14298
13 Ga0466716_296997 3300042605 Bacteria 12628
14 Ga0466716_501719 3300042605 Bacteria 2225
15 Ga0466698_155610 3300042610 Bacteria 1635
16 JGI24702J35022_10153904 3300002462 Unclassified 1292
17 JGI24703J35330_11747525 3300002501 Bacteria 7184
18 Ga0466705_016811 3300042612 Unclassified 4819
19 Ga0466703_107912 3300042636 Bacteria 3011
20 Ga0466704_074238 3300042643 Bacteria 20287
21 Ga0466704_282099 3300042643 Bacteria 2521
22 Ga0466709_162804 3300042648 Bacteria 11552
23 Ga0466709_378444 3300042648 Bacteria 4051
24 Ga0466708_440847 3300042652 Unclassified 3853
25 Ga0466712_041167 3300042614 Bacteria 1131
26 Ga0466715_110885 3300042616 Bacteria 15844
27 Ga0466723_214238 3300042618 Archaea 3604
28 Ga0466726_281879 3300042619 Bacteria 12324
29 Ga0466726_411774 3300042619 Bacteria 3762
30 Ga0466706_276716 3300042599 Bacteria 4085
31 JGI24702J35022_10135825 3300002462 Bacteria 1368
32 JGI24703J35330_11748844 3300002501 Bacteria 47873
33 Ga0466705_136405 3300042612 Bacteria 22908
34 Ga0466731_222583 3300042622 Bacteria 3897
35 Ga0466703_093440 3300042636 Bacteria 10108
36 Ga0466703_372294 3300042636 Bacteria 4316
37 Ga0466708_134179 3300042652 Bacteria 10863
38 Ga0466727_230481 3300042655 Bacteria 5384
39 Ga0466712_216195 3300042614 Bacteria 1028
40 Ga0466715_091879 3300042616 Bacteria 83726
41 Ga0466718_003976 3300042617 Bacteria 18604
42 Ga0466723_084141 3300042618 Bacteria 3355
43 Ga0466728_027988 3300042620 Bacteria 11375
44 Ga0466716_417638 3300042605 Bacteria 4396
45 Ga0466719_175728 3300042606 Bacteria 1539
46 Ga0466722_065813 3300042609 Bacteria 20228
47 Ga0466722_068537 3300042609 Bacteria 9473
48 Ga0466722_086768 3300042609 Bacteria 4194
49 Ga0456237_0000595 3300041968 Bacteria 5516
50 Ga0466690_395738 3300042590 Bacteria 3530
51 Ga0466692_067318 3300042591 Bacteria 1339
52 Ga0466691_006311 3300042593 Bacteria 23417
53 Ga0466691_109163 3300042593 Unclassified 7586
54 Ga0123355_10463252 3300009826 Bacteria 1589
55 JGI24703J35330_11693471 3300002501 Bacteria 1934
56 JGI24703J35330_11709260 3300002501 Bacteria 2149
57 Ga0466705_078473 3300042612 Bacteria 2759
58 Ga0466704_220247 3300042643 Bacteria 26948
59 Ga0466704_321429 3300042643 Bacteria 12925
60 Ga0466704_343782 3300042643 Bacteria 17755
61 Ga0466704_347511 3300042643 Bacteria 15892
62 Ga0466709_029560 3300042648 Bacteria 15471
63 Ga0466708_013695 3300042652 Bacteria 3048
64 Ga0466708_453395 3300042652 Bacteria 6437
65 Ga0466705_494692 3300042612 Bacteria 4013
66 Ga0466718_092489 3300042617 Bacteria 18817
67 Ga0466728_059531 3300042620 Bacteria 16113
68 Ga0466690_077392 3300042590 Unclassified 1456
69 Ga0466690_087861 3300042590 Bacteria 2707
70 Ga0466690_277685 3300042590 Unclassified 3125
71 Ga0466692_136979 3300042591 Bacteria 7451
72 Ga0466691_051434 3300042593 Bacteria 5494
73 Ga0466691_075053 3300042593 Bacteria 1955
74 Ga0466691_093702 3300042593 Bacteria 2556
75 Ga0466691_116762 3300042593 Bacteria 30098
76 Ga0466694_064813 3300042594 Bacteria 2197
77 Ga0466705_220157 3300042612 Unclassified 6772
78 Ga0466708_142070 3300042652 Bacteria 8638
79 Ga0466727_281289 3300042655 Bacteria 2799
80 Ga0466705_413416 3300042612 Bacteria 4249
81 Ga0466715_062239 3300042616 Bacteria 9585
82 Ga0466715_501881 3300042616 Bacteria 2986
83 Ga0466722_124486 3300042609 Bacteria 7416
84 Ga0466696_018031 3300042596 Bacteria 27289
85 Ga0466696_468716 3300042596 Bacteria 4625
86 AustNasuHG_c1000566 3300000089 Bacteria 13048
87 Ga0466703_285251 3300042636 Bacteria 7557
88 Ga0466704_105479 3300042643 Bacteria 2486
89 Ga0466715_109014 3300042616 Bacteria 4275
90 Ga0466715_255568 3300042616 Bacteria 1984
91 Ga0466723_058572 3300042618 Bacteria 2456
92 Ga0466723_177697 3300042618 Bacteria 19267
93 Ga0466728_008235 3300042620 Bacteria 1238
94 Ga0466706_280133 3300042599 Bacteria 1840
95 Ga0466716_313084 3300042605 Bacteria 7040
96 Ga0466690_070518 3300042590 Bacteria 13128
97 Ga0466690_200779 3300042590 Bacteria 11907
98 Ga0466735_136498 3300042624 Bacteria 1624
99 Ga0466735_212163 3300042624 Bacteria 24776
100 Ga0466703_023521 3300042636 Bacteria 3971
101 Ga0466704_054821 3300042643 Bacteria 1691
102 Ga0466708_327585 3300042652 Bacteria 2731
103 Ga0466705_467942 3300042612 Unclassified 3919
104 Ga0466705_469869 3300042612 Bacteria 11516
105 Ga0466726_003290 3300042619 Unclassified 8204
106 Ga0466726_356013 3300042619 Bacteria 7040
107 Ga0466726_488993 3300042619 Bacteria 18971
108 Ga0456237_0005633 3300041968 Bacteria 1981
109 Ga0466692_024573 3300042591 Bacteria 7738
110 Ga0466691_164853 3300042593 Bacteria 1760
111 Ga0466696_003582 3300042596 Bacteria 5487
112 Ga0466696_152055 3300042596 Bacteria 7895
113 JGI24702J35022_10154519 3300002462 Bacteria 1289
114 JGI24703J35330_11745055 3300002501 Bacteria 4417

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002462 JGI24702J35022_10153904 JGI24702J35022_101539042 217
2 3300009826 Ga0123355_10463252 Ga0123355_104632522 228
3 3300042593 Ga0466691_006311 Ga0466691_006311_13087_13797 236
4 3300042605 Ga0466716_417638 Ga0466716_417638_1603_2313 236
5 3300042655 Ga0466727_205366 Ga0466727_205366_13_795 239
6 3300042606 Ga0466719_175728 Ga0466719_175728_243_965 240
7 3300042614 Ga0466712_216195 Ga0466712_216195_204_1001 240
8 3300002449 JGI24698J34947_10066884 JGI24698J34947_100668842 241
9 3300002501 JGI24703J35330_11748844 JGI24703J35330_1174884427 241
10 3300042590 Ga0466690_395738 Ga0466690_395738_1028_1759 243
11 3300042593 Ga0466691_093702 Ga0466691_093702_221_952 243
12 3300042614 Ga0466712_041167 Ga0466712_041167_158_955 243
13 3300042618 Ga0466723_084141 Ga0466723_084141_799_1530 243
14 3300042620 Ga0466728_008235 Ga0466728_008235_407_1138 243
15 3300042643 Ga0466704_282099 Ga0466704_282099_1406_2137 243
16 3300042599 Ga0466706_280133 Ga0466706_280133_353_1090 245
17 3300042616 Ga0466715_091879 Ga0466715_091879_65601_66338 245
18 3300042609 Ga0466722_086768 Ga0466722_086768_2250_2990 246
19 3300042590 Ga0466690_200779 Ga0466690_200779_1462_2205 247
20 3300042593 Ga0466691_116762 Ga0466691_116762_25816_26559 247
21 3300042596 Ga0466696_018031 Ga0466696_018031_25080_25823 247
22 3300042612 Ga0466705_413416 Ga0466705_413416_1470_2213 247
23 3300042612 Ga0466705_494692 Ga0466705_494692_1462_2205 247
24 3300042617 Ga0466718_092489 Ga0466718_092489_9699_10442 247
25 3300042636 Ga0466703_107912 Ga0466703_107912_1710_2453 247
26 3300042636 Ga0466703_285251 Ga0466703_285251_1531_2274 247
27 3300042643 Ga0466704_105479 Ga0466704_105479_445_1251 247
28 3300042643 Ga0466704_347511 Ga0466704_347511_13670_14413 247
29 3300042617 Ga0466718_003976 Ga0466718_003976_9368_10114 248
30 3300042648 Ga0466709_162804 Ga0466709_162804_3228_3974 248
31 3300042610 Ga0466698_155610 Ga0466698_155610_287_1036 249
32 3300042612 Ga0466705_136405 Ga0466705_136405_21482_22231 249
33 3300042612 Ga0466705_469869 Ga0466705_469869_4579_5328 249
34 3300042619 Ga0466726_488993 Ga0466726_488993_867_1616 249
35 3300042643 Ga0466704_220247 Ga0466704_220247_17053_17802 249
36 iso_pr_bacteria 2820492969 2820495036 249
37 iso_pr_bacteria 2820641689 2820644172 249
38 3300002462 JGI24702J35022_10135825 JGI24702J35022_101358252 250
39 3300002462 JGI24702J35022_10154519 JGI24702J35022_101545192 250
40 3300002501 JGI24703J35330_11709260 JGI24703J35330_117092602 250
41 3300009826 Ga0123355_10044202 Ga0123355_100442023 250
42 3300042599 Ga0466706_276716 Ga0466706_276716_3300_4052 250
43 3300042596 Ga0466696_468716 Ga0466696_468716_1101_1856 251
44 3300042619 Ga0466726_281879 Ga0466726_281879_5358_6113 251
45 3300042655 Ga0466727_230481 Ga0466727_230481_2748_3503 251
46 3300042590 Ga0466690_087861 Ga0466690_087861_57_815 252
47 3300042593 Ga0466691_109163 Ga0466691_109163_920_1678 252
48 3300042593 Ga0466691_164853 Ga0466691_164853_314_1072 252
49 3300042605 Ga0466716_296997 Ga0466716_296997_11030_11788 252
50 3300042605 Ga0466716_313084 Ga0466716_313084_4201_4959 252
51 3300042612 Ga0466705_016811 Ga0466705_016811_3017_3775 252
52 3300042618 Ga0466723_058572 Ga0466723_058572_996_1754 252
53 3300042620 Ga0466728_012064 Ga0466728_012064_1051_1809 252
54 3300042643 Ga0466704_343782 Ga0466704_343782_8146_8904 252
55 3300042648 Ga0466709_029560 Ga0466709_029560_13276_14034 252
56 3300002501 JGI24703J35330_11693471 JGI24703J35330_116934712 253
57 3300002501 JGI24703J35330_11745055 JGI24703J35330_117450553 253
58 3300002501 JGI24703J35330_11747525 JGI24703J35330_117475253 253
59 3300041968 Ga0456237_0004774 Ga0456237_0004774_1232_1993 253
60 3300041968 Ga0456237_0005633 Ga0456237_0005633_585_1346 253
61 3300042591 Ga0466692_024573 Ga0466692_024573_1653_2414 253
62 3300042591 Ga0466692_136979 Ga0466692_136979_4150_4911 253
63 3300042591 Ga0466692_193197 Ga0466692_193197_1295_2056 253
64 3300042609 Ga0466722_065813 Ga0466722_065813_9754_10515 253
65 3300042609 Ga0466722_068537 Ga0466722_068537_7060_7821 253
66 3300042616 Ga0466715_109014 Ga0466715_109014_2462_3223 253
67 3300042643 Ga0466704_074238 Ga0466704_074238_6430_7191 253
68 3300042609 Ga0466722_124486 Ga0466722_124486_2079_2843 254
69 3300042612 Ga0466705_467942 Ga0466705_467942_1316_2080 254
70 3300042616 Ga0466715_062239 Ga0466715_062239_6504_7268 254
71 3300042618 Ga0466723_177697 Ga0466723_177697_12187_12951 254
72 3300042619 Ga0466726_003290 Ga0466726_003290_5908_6672 254
73 3300042620 Ga0466728_027988 Ga0466728_027988_3463_4227 254
74 3300042622 Ga0466731_222583 Ga0466731_222583_2028_2792 254
75 3300041968 Ga0456237_0000595 Ga0456237_0000595_1686_2453 255
76 3300042619 Ga0466726_411774 Ga0466726_411774_447_1217 256
77 3300042594 Ga0466694_064813 Ga0466694_064813_1015_1788 257
78 3300042605 Ga0466716_076206 Ga0466716_076206_11240_12013 257
79 3300042612 Ga0466705_078473 Ga0466705_078473_821_1594 257
80 3300042636 Ga0466703_023521 Ga0466703_023521_1801_2574 257
81 3300042643 Ga0466704_054821 Ga0466704_054821_278_1051 257
82 3300042590 Ga0466690_077392 Ga0466690_077392_402_1178 258
83 3300042593 Ga0466691_051434 Ga0466691_051434_1747_2523 258
84 3300042616 Ga0466715_110885 Ga0466715_110885_6859_7635 258
85 3300042636 Ga0466703_093440 Ga0466703_093440_8682_9458 258
86 3300042648 Ga0466709_378444 Ga0466709_378444_2451_3227 258
87 3300042652 Ga0466708_142070 Ga0466708_142070_2469_3245 258
88 iso_pr_bacteria 2781125629 2781264144 259
89 iso_pr_bacteria 2781125630 2781267060 259
90 3300042590 Ga0466690_070518 Ga0466690_070518_4198_4983 261
91 3300042590 Ga0466690_277685 Ga0466690_277685_905_1690 261
92 3300042593 Ga0466691_075053 Ga0466691_075053_524_1309 261
93 3300042605 Ga0466716_501719 Ga0466716_501719_179_964 261
94 3300042612 Ga0466705_220157 Ga0466705_220157_1208_1993 261
95 3300042616 Ga0466715_501881 Ga0466715_501881_1594_2379 261
96 3300042618 Ga0466723_214238 Ga0466723_214238_1290_2075 261
97 3300042636 Ga0466703_372294 Ga0466703_372294_2276_3061 261
98 3300042643 Ga0466704_321429 Ga0466704_321429_7095_7880 261
99 3300042648 Ga0466709_256423 Ga0466709_256423_2290_3075 261
100 3300042652 Ga0466708_013695 Ga0466708_013695_1355_2140 261
101 3300042652 Ga0466708_260186 Ga0466708_260186_2696_3481 261
102 3300042652 Ga0466708_327585 Ga0466708_327585_913_1698 261
103 3300042652 Ga0466708_440847 Ga0466708_440847_1815_2600 261
104 3300042652 Ga0466708_453395 Ga0466708_453395_4501_5286 261
105 3300000089 AustNasuHG_c1000566 AustNasuHG_10005667 263
106 3300042615 Ga0466711_308647 Ga0466711_308647_8899_9717 263
107 3300042616 Ga0466715_255568 Ga0466715_255568_1002_1793 263
108 3300042655 Ga0466727_281289 Ga0466727_281289_37_828 263
109 3300042596 Ga0466696_152055 Ga0466696_152055_2490_3287 265
110 3300042624 Ga0466735_212163 Ga0466735_212163_21025_21882 265
111 3300042624 Ga0466735_136498 Ga0466735_136498_313_1158 266
112 3300042648 Ga0466709_416174 Ga0466709_416174_243_1046 267
113 3300042652 Ga0466708_134179 Ga0466708_134179_5551_6354 267
114 3300042596 Ga0466696_003582 Ga0466696_003582_3458_4264 268
115 3300042591 Ga0466692_067318 Ga0466692_067318_42_851 269
116 3300042591 Ga0466692_151515 Ga0466692_151515_2397_3206 269
117 3300042620 Ga0466728_059531 Ga0466728_059531_1775_2590 271
118 3300042619 Ga0466726_356013 Ga0466726_356013_2970_3860 296

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 67 210 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.