Protein Family IF08318

Metagenome Isolate
119 Members
35 Samples
111 Scaffolds
524.34 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_353095|Ga0466726_353095_4050_5732
Length
560 aa
Sequence
MLTMFSSRHEPNSLAQTEKLCCNGVMKHKLPVGIQDFVGIREDGCYYVDKTALIHTLVNGSGKTFFLSRPRRFGKSLLCSTLGALFDGRRELFAASAAQPALAIDSLEWDWKKHPVIRIDLSPGNYERGVNELLATINTALGLCARKYGVALEGDTISAQFMRLINTLREKAGEKVVVIIDEYDKPLLSTIDEPALHKEMRSTLKGFYSVLKATDGDLRFTFLTGVTKFSHVSVFSDLNHITDISLEPRYAELCGITQEELERNFADEISEIIQNKGTKRETYLMEVKQFYNGYRFSRKPLTVYNPYGLLKHFYSGGEFLPFWFESGTPTFLIKLIENQHINILDLGKQTVRYAXXXXYDVETMQAVPVLYQSGYLTINEYNSEEDVFSLDYPNAEVRASFAESLAEKYLRVPDENLSAFIINFISAIYKGNVDYMMNALKPLIASIPHDLITKNENENYYQTVIHLVFTMMGLQCRSEVRIADGRIDTLLETSKFVYCFEFKLEGSAQTALAQIDSKDYLLPWRGRGKKLFKVGVNFDREKRNISEWKVEIKEKASDND

📊 Sample Types

Isolate 5.0%
Metagenome 95.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 61.8%
Kalotermitidae 17.6%
Unclassified 8.8%
Termopsidae 5.9%
Rhinotermitidae 2.9%
Hodotermitidae 2.9%

🌳 Taxonomy

Archaea 0
Bacteria 103
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
2 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
12 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
13 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
14 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
15 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
16 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
19 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
20 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
21 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
22 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
23 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
26 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
29 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
30 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
31 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
32 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
33 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
34 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
35 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466693_428957 3300042592 Bacteria 2316
2 JGI24698J34947_10041151 3300002449 Bacteria 2381
3 JGI24698J34947_10064431 3300002449 Unclassified 1791
4 JGI24695J34938_10001245 3300002450 Bacteria 22388
5 JGI24695J34938_10018142 3300002450 Bacteria 3526
6 JGI24695J34938_10025560 3300002450 Bacteria 2821
7 JGI24695J34938_10029296 3300002450 Bacteria 2576
8 Ga0466702_286724 3300042635 Bacteria 1910
9 Ga0466718_078321 3300042617 Bacteria 3822
10 Ga0123356_10002325 3300010049 Bacteria 20420
11 Ga0123356_10194940 3300010049 Bacteria 2060
12 Ga0466692_001492 3300042591 Unclassified 4970
13 Ga0466692_027233 3300042591 Bacteria 2589
14 Ga0466693_202942 3300042592 Bacteria 4516
15 Ga0466699_245162 3300042597 Bacteria 3148
16 JGI24698J34947_10002089 3300002449 Unclassified 10678
17 JGI24698J34947_10041988 3300002449 Unclassified 2352
18 JGI24695J34938_10002516 3300002450 Bacteria 13888
19 JGI24695J34938_10012394 3300002450 Bacteria 4520
20 JGI24695J34938_10047619 3300002450 Unclassified 1892
21 Ga0466697_110295 3300042611 Bacteria 1803
22 Ga0466733_039624 3300042659 Bacteria 4607
23 Ga0466727_023860 3300042655 Bacteria 2508
24 Ga0466712_020759 3300042614 Bacteria 22637
25 Ga0466712_088268 3300042614 Bacteria 28448
26 Ga0466711_429850 3300042615 Bacteria 8654
27 Ga0123356_10001109 3300010049 Bacteria 29839
28 AustNasuHG_c1001201 3300000089 Bacteria 9340
29 JGI24695J34938_10010319 3300002450 Bacteria 5125
30 JGI24695J34938_10026788 3300002450 Unclassified 2735
31 JGI24695J34938_10032906 3300002450 Bacteria 2390
32 Ga0466732_092386 3300042656 Bacteria 77086
33 Ga0466733_123789 3300042659 Unclassified 4140
34 Ga0466733_162557 3300042659 Bacteria 4828
35 Ga0466734_089901 3300042623 Bacteria 8669
36 Ga0466702_132787 3300042635 Bacteria 10258
37 Ga0466704_140919 3300042643 Bacteria 2582
38 Ga0466704_539792 3300042643 Bacteria 20551
39 Ga0466726_205548 3300042619 Bacteria 3108
40 Ga0123353_10168282 3300010167 Bacteria 3481
41 Ga0415639_030398 3300038395 Bacteria 5599
42 Ga0466696_479880 3300042596 Bacteria 3017
43 JGI24698J34947_10000470 3300002449 Bacteria 18822
44 JGI24698J34947_10001113 3300002449 Bacteria 13873
45 JGI24698J34947_10026860 3300002449 Bacteria 3056
46 JGI24695J34938_10006105 3300002450 Bacteria 7333
47 Ga0466702_019493 3300042635 Bacteria 13895
48 Ga0466702_374371 3300042635 Unclassified 2093
49 Ga0466712_176373 3300042614 Bacteria 2436
50 Ga0466712_231274 3300042614 Bacteria 8762
51 Ga0466718_153549 3300042617 Bacteria 7633
52 Ga0466726_188268 3300042619 Bacteria 2763
53 Ga0123355_10263758 3300009826 Bacteria 2405
54 Ga0123356_10000116 3300010049 Bacteria 86622
55 Ga0123356_10000407 3300010049 Bacteria 48938
56 Ga0123356_10066193 3300010049 Bacteria 3382
57 Ga0123356_10147779 3300010049 Unclassified 2328
58 Ga0264413_100365 3300024493 Bacteria 60695
59 Ga0466692_068076 3300042591 Bacteria 1846
60 Ga0466694_212383 3300042594 Unclassified 2450
61 AustNasuHG_c1011287 3300000089 Bacteria 3098
62 JGI24698J34947_10000094 3300002449 Bacteria 30023
63 JGI24698J34947_10044202 3300002449 Bacteria 2282
64 JGI24695J34938_10014826 3300002450 Bacteria 4020
65 Ga0466720_183123 3300042607 Bacteria 5841
66 Ga0466698_505193 3300042610 Unclassified 3458
67 Ga0466703_387136 3300042636 Bacteria 5359
68 Ga0466712_069189 3300042614 Bacteria 44669
69 Ga0466712_104714 3300042614 Bacteria 7239
70 Ga0466712_215762 3300042614 Bacteria 3744
71 Ga0466711_511514 3300042615 Bacteria 38268
72 Ga0466715_440179 3300042616 Unclassified 2377
73 Ga0466726_353095 3300042619 Bacteria 7085
74 Ga0466726_453231 3300042619 Bacteria 23036
75 Ga0123354_10086018 3300010882 Bacteria 4398
76 Ga0466692_005486 3300042591 Bacteria 6558
77 Ga0466699_084058 3300042597 Bacteria 3689
78 Ga0466699_237087 3300042597 Bacteria 3821
79 AustNasuHG_c1009165 3300000089 Bacteria 3483
80 JGI24698J34947_10000037 3300002449 Bacteria 37292
81 JGI24698J34947_10003851 3300002449 Bacteria 8158
82 Ga0466726_083553 3300042619 Bacteria 12952
83 Ga0123353_10118728 3300010167 Bacteria 4253
84 Ga0123353_10326946 3300010167 Bacteria 2324
85 Ga0466692_024117 3300042591 Bacteria 20878
86 Ga0466691_066384 3300042593 Unclassified 2395
87 Ga0466691_178371 3300042593 Bacteria 6881
88 Ga0466699_288250 3300042597 Bacteria 7420
89 JGI24698J34947_10000739 3300002449 Bacteria 16118
90 JGI24698J34947_10006143 3300002449 Bacteria 6595
91 JGI24695J34938_10045060 3300002450 Unclassified 1958
92 Ga0123357_10001382 3300009784 Bacteria 25711
93 Ga0466706_122963 3300042599 Bacteria 4828
94 Ga0466697_113999 3300042611 Bacteria 2825
95 Ga0466733_011791 3300042659 Bacteria 4189
96 Ga0466704_014670 3300042643 Bacteria 10347
97 Ga0466704_273433 3300042643 Bacteria 4983
98 Ga0466712_061132 3300042614 Bacteria 4393
99 Ga0123356_10237496 3300010049 Bacteria 1891
100 Ga0123354_10042664 3300010882 Unclassified 6987
101 Ga0415639_047458 3300038395 Bacteria 16794
102 Ga0415639_116078 3300038395 Bacteria 3511
103 Ga0466692_066748 3300042591 Bacteria 5046
104 Ga0466699_020470 3300042597 Bacteria 6592
105 JGI24698J34947_10052421 3300002449 Bacteria 2047
106 JGI24695J34938_10006043 3300002450 Bacteria 7380
107 Ga0466720_203602 3300042607 Bacteria 2208
108 Ga0466702_333210 3300042635 Bacteria 1906
109 Ga0466702_360116 3300042635 Bacteria 2283
110 Ga0466715_356809 3300042616 Bacteria 4579
111 Ga0466718_072078 3300042617 Bacteria 2912

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300038395 Ga0415639_116078 Ga0415639_116078_1585_3009 459
2 3300010049 Ga0123356_10066193 Ga0123356_100661938 485
3 3300042643 Ga0466704_539792 Ga0466704_539792_12802_14388 490
4 3300010049 Ga0123356_10000116 Ga0123356_100001169 491
5 3300042617 Ga0466718_072078 Ga0466718_072078_1205_2683 492
6 3300002449 JGI24698J34947_10006143 JGI24698J34947_100061432 497
7 iso_pr_bacteria 2781125687 2781421913 502
8 3300042635 Ga0466702_374371 Ga0466702_374371_247_1764 505
9 3300002449 JGI24698J34947_10000739 JGI24698J34947_1000073915 506
10 3300042619 Ga0466726_453231 Ga0466726_453231_8026_9588 507
11 3300002450 JGI24695J34938_10029296 JGI24695J34938_100292962 512
12 3300042635 Ga0466702_286724 Ga0466702_286724_79_1668 515
13 3300009826 Ga0123355_10263758 Ga0123355_102637581 516
14 3300002449 JGI24698J34947_10041988 JGI24698J34947_100419882 517
15 3300042607 Ga0466720_203602 Ga0466720_203602_532_2133 517
16 3300042593 Ga0466691_178371 Ga0466691_178371_3271_4827 518
17 3300042597 Ga0466699_084058 Ga0466699_084058_155_1711 518
18 3300042597 Ga0466699_245162 Ga0466699_245162_202_1758 518
19 3300042607 Ga0466720_183123 Ga0466720_183123_3190_4782 518
20 3300002450 JGI24695J34938_10047619 JGI24695J34938_100476191 519
21 3300010167 Ga0123353_10168282 Ga0123353_101682822 519
22 3300002449 JGI24698J34947_10001113 JGI24698J34947_100011136 521
23 3300002449 JGI24698J34947_10041151 JGI24698J34947_100411512 521
24 3300002450 JGI24695J34938_10002516 JGI24695J34938_1000251610 521
25 3300002450 JGI24695J34938_10006105 JGI24695J34938_100061059 522
26 3300010167 Ga0123353_10326946 Ga0123353_103269461 522
27 3300042592 Ga0466693_202942 Ga0466693_202942_1055_2623 522
28 3300042599 Ga0466706_122963 Ga0466706_122963_75_1643 522
29 3300002450 JGI24695J34938_10006043 JGI24695J34938_100060433 523
30 3300002450 JGI24695J34938_10026788 JGI24695J34938_100267881 523
31 3300042614 Ga0466712_176373 Ga0466712_176373_276_1847 523
32 3300042619 Ga0466726_083553 Ga0466726_083553_8972_10543 523
33 3300042623 Ga0466734_089901 Ga0466734_089901_3451_5022 523
34 3300010049 Ga0123356_10147779 Ga0123356_101477792 524
35 3300042597 Ga0466699_288250 Ga0466699_288250_1784_3358 524
36 3300042610 Ga0466698_505193 Ga0466698_505193_737_2311 524
37 3300042614 Ga0466712_061132 Ga0466712_061132_2041_3615 524
38 3300042615 Ga0466711_511514 Ga0466711_511514_9305_10879 524
39 3300042619 Ga0466726_188268 Ga0466726_188268_1111_2685 524
40 3300042656 Ga0466732_092386 Ga0466732_092386_52258_53832 524
41 3300042659 Ga0466733_039624 Ga0466733_039624_1950_3524 524
42 3300042659 Ga0466733_123789 Ga0466733_123789_2160_3734 524
43 3300042659 Ga0466733_123789 Ga0466733_123789_498_2072 524
44 3300002450 JGI24695J34938_10012394 JGI24695J34938_100123944 525
45 3300010049 Ga0123356_10002325 Ga0123356_100023254 525
46 3300042591 Ga0466692_005486 Ga0466692_005486_3009_4586 525
47 3300042614 Ga0466712_215762 Ga0466712_215762_1585_3162 525
48 3300042643 Ga0466704_014670 Ga0466704_014670_1104_2699 525
49 3300042655 Ga0466727_023860 Ga0466727_023860_518_2095 525
50 iso_pr_bacteria 2781125659 2781327047 525
51 3300000089 AustNasuHG_c1009165 AustNasuHG_10091652 526
52 3300000089 AustNasuHG_c1011287 AustNasuHG_10112873 526
53 3300002449 JGI24698J34947_10000094 JGI24698J34947_1000009423 526
54 3300002449 JGI24698J34947_10026860 JGI24698J34947_100268602 526
55 3300002450 JGI24695J34938_10001245 JGI24695J34938_100012454 526
56 3300002450 JGI24695J34938_10010319 JGI24695J34938_100103192 526
57 3300002450 JGI24695J34938_10018142 JGI24695J34938_100181423 526
58 3300010049 Ga0123356_10001109 Ga0123356_1000110926 526
59 3300042597 Ga0466699_237087 Ga0466699_237087_1229_2809 526
60 3300042611 Ga0466697_113999 Ga0466697_113999_344_1924 526
61 3300042617 Ga0466718_078321 Ga0466718_078321_99_1679 526
62 3300042636 Ga0466703_387136 Ga0466703_387136_591_2171 526
63 3300042659 Ga0466733_011791 Ga0466733_011791_2033_3613 526
64 3300002449 JGI24698J34947_10000037 JGI24698J34947_100000373 527
65 3300002449 JGI24698J34947_10044202 JGI24698J34947_100442022 527
66 3300009784 Ga0123357_10001382 Ga0123357_1000138215 527
67 3300024493 Ga0264413_100365 Ga0264413_10036535 527
68 3300042591 Ga0466692_066748 Ga0466692_066748_3380_4963 527
69 3300042591 Ga0466692_068076 Ga0466692_068076_110_1693 527
70 3300042611 Ga0466697_110295 Ga0466697_110295_54_1637 527
71 3300042614 Ga0466712_104714 Ga0466712_104714_2417_4000 527
72 3300042615 Ga0466711_429850 Ga0466711_429850_130_1713 527
73 3300042616 Ga0466715_356809 Ga0466715_356809_592_2175 527
74 3300042617 Ga0466718_153549 Ga0466718_153549_5125_6708 527
75 3300042635 Ga0466702_019493 Ga0466702_019493_10093_11676 527
76 3300042635 Ga0466702_333210 Ga0466702_333210_250_1833 527
77 3300042635 Ga0466702_360116 Ga0466702_360116_564_2147 527
78 iso_pr_bacteria 2781125662 2781335522 527
79 iso_pr_bacteria 2781125687 2781420258 527
80 3300000089 AustNasuHG_c1001201 AustNasuHG_10012016 528
81 3300002449 JGI24698J34947_10000470 JGI24698J34947_100004709 528
82 3300002449 JGI24698J34947_10002089 JGI24698J34947_100020897 528
83 3300002449 JGI24698J34947_10003851 JGI24698J34947_100038514 528
84 3300002450 JGI24695J34938_10032906 JGI24695J34938_100329062 528
85 3300010167 Ga0123353_10118728 Ga0123353_101187284 528
86 3300010882 Ga0123354_10042664 Ga0123354_100426645 528
87 3300038395 Ga0415639_047458 Ga0415639_047458_14102_15688 528
88 3300042591 Ga0466692_024117 Ga0466692_024117_17584_19170 528
89 3300042594 Ga0466694_212383 Ga0466694_212383_282_1868 528
90 3300042614 Ga0466712_020759 Ga0466712_020759_5650_7236 528
91 3300042614 Ga0466712_069189 Ga0466712_069189_7124_8710 528
92 3300002450 JGI24695J34938_10014826 JGI24695J34938_100148262 529
93 3300010049 Ga0123356_10194940 Ga0123356_101949401 529
94 3300042592 Ga0466693_428957 Ga0466693_428957_350_1939 529
95 3300042593 Ga0466691_066384 Ga0466691_066384_204_1793 529
96 3300042643 Ga0466704_140919 Ga0466704_140919_39_1628 529
97 iso_pr_bacteria 2781125662 2781336119 529
98 3300002449 JGI24698J34947_10064431 JGI24698J34947_100644311 530
99 3300002450 JGI24695J34938_10045060 JGI24695J34938_100450602 530
100 3300010049 Ga0123356_10000407 Ga0123356_1000040717 530
101 3300042614 Ga0466712_088268 Ga0466712_088268_10652_12244 530
102 3300042659 Ga0466733_162557 Ga0466733_162557_1815_3407 530
103 iso_pr_bacteria 2781125687 2781421026 530
104 3300010882 Ga0123354_10086018 Ga0123354_100860181 531
105 3300038395 Ga0415639_030398 Ga0415639_030398_2647_4242 531
106 3300042614 Ga0466712_231274 Ga0466712_231274_3023_4621 532
107 3300042643 Ga0466704_273433 Ga0466704_273433_2497_4095 532
108 3300042596 Ga0466696_479880 Ga0466696_479880_1057_2658 533
109 3300042619 Ga0466726_205548 Ga0466726_205548_1043_2653 536
110 3300042635 Ga0466702_132787 Ga0466702_132787_5805_7415 536
111 3300010049 Ga0123356_10237496 Ga0123356_102374961 537
112 3300042591 Ga0466692_027233 Ga0466692_027233_728_2344 538
113 3300042619 Ga0466726_453231 Ga0466726_453231_10323_11942 539
114 3300002449 JGI24698J34947_10052421 JGI24698J34947_100524211 540
115 3300002450 JGI24695J34938_10025560 JGI24695J34938_100255603 540
116 3300042591 Ga0466692_001492 Ga0466692_001492_2803_4428 541
117 3300042616 Ga0466715_440179 Ga0466715_440179_202_1863 553
118 3300042597 Ga0466699_020470 Ga0466699_020470_4846_6516 556
119 3300042619 Ga0466726_353095 Ga0466726_353095_4050_5732 560

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF08011 PDDEXK_9 PD-(D/E)XK nuclease superfamily 456 548 0.98
PF09820 AAA-ATPase_like Predicted AAA-ATPase 31 313 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.