Protein Family IF08300

Metagenome Isolate
138 Members
54 Samples
126 Scaffolds
248.6 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_310071|Ga0466726_310071_4715_5536
Length
273 aa
Sequence
MRAWIEKIRSKAFMDRKINVTIYNENLHETTVDSVRALYPNGIHGVIKGFLEKDSAIGTIRCATFADHKEILTQQVLDDTDVMIWWGHMKHDAVDDAVVXXXVTRVLGGMGFIALHSGHASKPFGRLLGTETHLLRWREAGEKARLWNIAKNHRITKGLPQTFVVPHDETYGEPFGIPEPDELIFLTWFQGGEVFRSGCAWRRGEGNIFYLQNGHETFPVYYQPEIQLVISNAVHWACPVQRVCTLDRGGPNAAPLEAYTLEDGGGFTPITRS

📊 Sample Types

Isolate 8.0%
Metagenome 92.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 38.9%
Kalotermitidae 22.2%
Unclassified 20.4%
Rhinotermitidae 7.4%
Termopsidae 5.6%
Passalidae 3.7%
Hodotermitidae 1.9%

🌳 Taxonomy

Archaea 2
Bacteria 122
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
9 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
10 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
16 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
17 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
18 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
19 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
20 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
21 2820657860 Unclassified Firmicutes Co191P4bin15 Isolate Unclassified
22 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
23 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
24 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
25 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
26 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
27 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
28 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
29 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
30 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
31 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
32 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
33 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
34 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
35 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
36 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
37 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
38 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
39 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
40 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
41 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
42 2820391468 Unclassified Firmicutes Nc150P3bin1 Isolate Unclassified
43 2820429680 Unclassified Firmicutes Lab288P3bin30 Isolate Unclassified
44 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
45 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
46 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
47 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
48 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
49 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
50 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
51 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
52 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
53 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
54 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_217315 3300042612 Bacteria 6855
2 Ga0466723_146583 3300042618 Bacteria 4513
3 Ga0466728_021715 3300042620 Unclassified 3713
4 Ga0466704_273736 3300042643 Unclassified 3763
5 Ga0466709_009097 3300042648 Unclassified 14066
6 Ga0466708_047798 3300042652 Bacteria 3805
7 Ga0415639_108022 3300038395 Bacteria 5011
8 Ga0466690_059556 3300042590 Bacteria 1757
9 Ga0466694_012479 3300042594 Bacteria 1760
10 Ga0466694_403891 3300042594 Bacteria 1982
11 Ga0466701_043274 3300042598 Bacteria 1715
12 Ga0466719_388875 3300042606 Bacteria 2045
13 Ga0466719_423876 3300042606 Bacteria 8084
14 Ga0123356_10301634 3300010049 Bacteria 1707
15 Ga0123353_10190365 3300010167 Bacteria 3239
16 Ga0123354_10489535 3300010882 Unclassified 966
17 2227303005 2225789004 Bacteria 29397
18 JGI24702J35022_10029215 3300002462 Unclassified 2959
19 Ga0466705_054847 3300042612 Bacteria 8005
20 Ga0466733_159567 3300042659 Unclassified 1263
21 Ga0466718_170298 3300042617 Bacteria 16664
22 Ga0466723_254832 3300042618 Bacteria 8953
23 Ga0466726_105607 3300042619 Bacteria 4333
24 Ga0466703_041775 3300042636 Bacteria 7763
25 Ga0466727_001217 3300042655 Bacteria 1351
26 Ga0466727_039508 3300042655 Bacteria 3023
27 Ga0466727_283679 3300042655 Bacteria 2246
28 Ga0466696_238986 3300042596 Bacteria 3275
29 Ga0466699_001046 3300042597 Bacteria 6902
30 Ga0123353_10078498 3300010167 Bacteria 5306
31 Ga0123353_10103036 3300010167 Unclassified 4600
32 Ga0123354_10420427 3300010882 Archaea 1111
33 JGI24702J35022_10007589 3300002462 Bacteria 6207
34 JGI24705J35276_12223574 3300002504 Bacteria 2524
35 Ga0466705_443902 3300042612 Bacteria 4145
36 Ga0466726_310071 3300042619 Bacteria 9297
37 Ga0466728_062721 3300042620 Bacteria 4279
38 Ga0466703_151321 3300042636 Bacteria 26945
39 Ga0466727_129586 3300042655 Bacteria 2690
40 Ga0466727_150207 3300042655 Bacteria 2374
41 Ga0415639_022500 3300038395 Bacteria 4726
42 Ga0466691_177072 3300042593 Bacteria 1530
43 Ga0466720_181167 3300042607 Bacteria 1914
44 Ga0123356_10674157 3300010049 Bacteria 1202
45 Ga0123353_10016205 3300010167 Bacteria 10879
46 Ga0123353_10317609 3300010167 Bacteria 2366
47 JGI24702J35022_10009341 3300002462 Bacteria 5506
48 JGI24696J40584_12959513 3300002834 Bacteria 5228
49 JGI24696J40584_12960447 3300002834 Bacteria 7280
50 Ga0466733_012094 3300042659 Unclassified 1379
51 Ga0466735_142440 3300042624 Bacteria 3251
52 Ga0466704_019245 3300042643 Bacteria 5002
53 Ga0466704_464040 3300042643 Unclassified 2947
54 Ga0415639_077284 3300038395 Bacteria 4045
55 Ga0415639_090963 3300038395 Bacteria 3474
56 Ga0466694_223825 3300042594 Bacteria 36366
57 Ga0466694_249415 3300042594 Bacteria 1320
58 Ga0466696_157311 3300042596 Bacteria 7047
59 Ga0466696_179610 3300042596 Bacteria 4353
60 Ga0466706_009298 3300042599 Bacteria 6037
61 Ga0123353_10192755 3300010167 Unclassified 3215
62 JGI24695J34938_10000079 3300002450 Bacteria 82620
63 JGI24702J35022_10010274 3300002462 Unclassified 5234
64 Ga0466733_007910 3300042659 Bacteria 2002
65 Ga0466715_136168 3300042616 Bacteria 23992
66 Ga0466723_240466 3300042618 Bacteria 15139
67 Ga0466703_051734 3300042636 Bacteria 4928
68 Ga0466704_482461 3300042643 Bacteria 2979
69 Ga0466690_009127 3300042590 Bacteria 6648
70 Ga0466707_351852 3300042601 Bacteria 4703
71 Ga0466719_221593 3300042606 Bacteria 8967
72 Ga0123355_10106616 3300009826 Bacteria 4393
73 Ga0123356_10021658 3300010049 Bacteria 6066
74 Ga0123356_10107252 3300010049 Bacteria 2691
75 Ga0123354_10423720 3300010882 Bacteria 1103
76 Ga0466726_318983 3300042619 Bacteria 2466
77 Ga0466726_438498 3300042619 Bacteria 1085
78 Ga0466727_106293 3300042655 Bacteria 1227
79 Ga0466727_241335 3300042655 Bacteria 6689
80 Ga0466727_266548 3300042655 Unclassified 2509
81 Ga0456237_0008522 3300041968 Bacteria 1544
82 Ga0466691_052044 3300042593 Bacteria 24535
83 Ga0466691_199020 3300042593 Bacteria 3353
84 Ga0466722_164901 3300042609 Bacteria 1597
85 Ga0123356_10023173 3300010049 Bacteria 5848
86 Ga0123356_10502613 3300010049 Bacteria 1368
87 Ga0123356_10808635 3300010049 Bacteria 1108
88 Ga0466733_170153 3300042659 Bacteria 1157
89 Ga0466726_162097 3300042619 Bacteria 1112
90 Ga0466726_433112 3300042619 Archaea 1401
91 Ga0466703_025105 3300042636 Bacteria 4646
92 Ga0466703_200655 3300042636 Bacteria 4636
93 Ga0466703_347080 3300042636 Bacteria 10047
94 Ga0466727_153418 3300042655 Bacteria 1897
95 Ga0466692_069907 3300042591 Unclassified 1644
96 Ga0466699_003624 3300042597 Bacteria 19542
97 Ga0466699_115488 3300042597 Bacteria 3783
98 Ga0466699_402130 3300042597 Bacteria 1804
99 Ga0466713_030932 3300042602 Bacteria 92656
100 Ga0466714_161898 3300042603 Bacteria 1254
101 Ga0466719_029177 3300042606 Bacteria 2365
102 Ga0466719_178000 3300042606 Bacteria 20502
103 Ga0123356_10123106 3300010049 Bacteria 2527
104 Ga0123356_10451694 3300010049 Bacteria 1433
105 Ga0123353_10000420 3300010167 Bacteria 52431
106 Ga0123353_10039618 3300010167 Bacteria 7422
107 IMNBL1DRAFT_c0000022 3300000062 Bacteria 148036
108 AustNasuHG_c1038409 3300000089 Bacteria 1206
109 Ga0072940_1427068 3300005200 Bacteria 942
110 Ga0466705_049050 3300042612 Bacteria 6405
111 Ga0466718_131007 3300042617 Bacteria 2291
112 Ga0466729_216908 3300042621 Bacteria 16052
113 Ga0466731_253896 3300042622 Bacteria 1947
114 Ga0466703_009474 3300042636 Bacteria 5907
115 Ga0466704_154549 3300042643 Bacteria 24370
116 Ga0466708_271808 3300042652 Bacteria 5080
117 Ga0466693_007221 3300042592 Bacteria 1367
118 Ga0466699_129934 3300042597 Bacteria 3966
119 Ga0466699_215643 3300042597 Bacteria 1260
120 Ga0123353_10000539 3300010167 Bacteria 46894
121 Ga0123353_10027320 3300010167 Bacteria 8744
122 Ga0123353_10045734 3300010167 Bacteria 6950
123 Ga0123353_10296520 3300010167 Bacteria 2472
124 Ga0123353_10691068 3300010167 Bacteria 1434
125 IMNBL1DRAFT_c0002747 3300000062 Unclassified 11962
126 JGI24702J35022_10005627 3300002462 Bacteria 7306

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002462 JGI24702J35022_10009341 JGI24702J35022_100093413 230
2 3300010049 Ga0123356_10023173 Ga0123356_100231732 234
3 3300002462 JGI24702J35022_10029215 JGI24702J35022_100292152 238
4 3300010049 Ga0123356_10674157 Ga0123356_106741572 238
5 3300042594 Ga0466694_012479 Ga0466694_012479_118_837 239
6 3300042617 Ga0466718_131007 Ga0466718_131007_225_944 239
7 3300042617 Ga0466718_170298 Ga0466718_170298_13030_13749 239
8 iso_pr_bacteria 2820391468 2820392979 239
9 iso_pr_bacteria 2820657860 2820659824 239
10 iso_pr_bacteria 2820663833 2820665174 239
11 iso_pr_bacteria 2820698910 2820700435 239
12 3300000062 IMNBL1DRAFT_c0000022 IMNBL1DRAFT_000002244 240
13 3300002450 JGI24695J34938_10000079 JGI24695J34938_1000007941 240
14 3300002462 JGI24702J35022_10005627 JGI24702J35022_100056273 240
15 3300002462 JGI24702J35022_10007589 JGI24702J35022_100075893 240
16 3300002462 JGI24702J35022_10010274 JGI24702J35022_100102745 240
17 3300002834 JGI24696J40584_12959513 JGI24696J40584_129595133 240
18 3300002834 JGI24696J40584_12960447 JGI24696J40584_129604474 240
19 3300010049 Ga0123356_10451694 Ga0123356_104516942 240
20 3300010167 Ga0123353_10000420 Ga0123353_100004204 240
21 3300010167 Ga0123353_10045734 Ga0123353_100457343 240
22 3300010167 Ga0123353_10078498 Ga0123353_100784983 240
23 3300010167 Ga0123353_10296520 Ga0123353_102965203 240
24 3300010167 Ga0123353_10317609 Ga0123353_103176093 240
25 3300010882 Ga0123354_10489535 Ga0123354_104895352 240
26 3300042603 Ga0466714_161898 Ga0466714_161898_467_1207 240
27 3300010049 Ga0123356_10021658 Ga0123356_100216584 241
28 3300010167 Ga0123353_10016205 Ga0123353_1001620510 241
29 3300042599 Ga0466706_009298 Ga0466706_009298_4903_5628 241
30 3300042616 Ga0466715_136168 Ga0466715_136168_21359_22084 241
31 3300042643 Ga0466704_273736 Ga0466704_273736_674_1453 241
32 3300010049 Ga0123356_10123106 Ga0123356_101231063 242
33 3300038395 Ga0415639_022500 Ga0415639_022500_981_1709 242
34 3300042609 Ga0466722_164901 Ga0466722_164901_799_1527 242
35 3300042659 Ga0466733_007910 Ga0466733_007910_1208_1936 242
36 iso_pr_bacteria 2820391468 2820391516 242
37 3300009826 Ga0123355_10106616 Ga0123355_101066163 243
38 3300010167 Ga0123353_10016205 Ga0123353_100162057 243
39 3300010167 Ga0123353_10192755 Ga0123353_101927552 243
40 3300042592 Ga0466693_007221 Ga0466693_007221_38_769 243
41 3300042594 Ga0466694_223825 Ga0466694_223825_34247_34978 243
42 3300042594 Ga0466694_249415 Ga0466694_249415_210_941 243
43 3300042594 Ga0466694_403891 Ga0466694_403891_1132_1863 243
44 3300042597 Ga0466699_001046 Ga0466699_001046_3432_4163 243
45 3300042597 Ga0466699_003624 Ga0466699_003624_5202_5933 243
46 3300042597 Ga0466699_115488 Ga0466699_115488_386_1117 243
47 3300042597 Ga0466699_129934 Ga0466699_129934_2853_3584 243
48 3300042597 Ga0466699_215643 Ga0466699_215643_192_923 243
49 3300042597 Ga0466699_402130 Ga0466699_402130_947_1678 243
50 3300042607 Ga0466720_181167 Ga0466720_181167_257_988 243
51 3300042612 Ga0466705_054847 Ga0466705_054847_1665_2396 243
52 3300042636 Ga0466703_347080 Ga0466703_347080_1882_2613 243
53 3300042643 Ga0466704_482461 Ga0466704_482461_336_1067 243
54 3300042659 Ga0466733_170153 Ga0466733_170153_347_1078 243
55 iso_pr_bacteria 2820362221 2820363441 243
56 3300000089 AustNasuHG_c1038409 AustNasuHG_10384092 244
57 3300005200 Ga0072940_1427068 Ga0072940_14270682 244
58 3300010167 Ga0123353_10103036 Ga0123353_101030363 244
59 3300010167 Ga0123353_10190365 Ga0123353_101903653 244
60 3300010882 Ga0123354_10423720 Ga0123354_104237201 244
61 iso_pr_bacteria 2576861701 2579272395 244
62 iso_pr_bacteria 2820429680 2820430338 244
63 3300010049 Ga0123356_10301634 Ga0123356_103016342 245
64 3300010167 Ga0123353_10000539 Ga0123353_1000053916 245
65 3300042602 Ga0466713_030932 Ga0466713_030932_29452_30189 245
66 3300042655 Ga0466727_150207 Ga0466727_150207_1448_2185 245
67 iso_pr_bacteria 2781125666 2781342929 245
68 2225789004 2227303005 2227753060 246
69 3300010167 Ga0123353_10039618 Ga0123353_100396189 246
70 3300038395 Ga0415639_090963 Ga0415639_090963_2049_2789 246
71 3300038395 Ga0415639_108022 Ga0415639_108022_2857_3597 246
72 3300042620 Ga0466728_021715 Ga0466728_021715_993_1772 246
73 3300042636 Ga0466703_025105 Ga0466703_025105_2144_2884 246
74 3300000062 IMNBL1DRAFT_c0002747 IMNBL1DRAFT_00027477 247
75 3300010049 Ga0123356_10107252 Ga0123356_101072523 247
76 3300010882 Ga0123354_10420427 Ga0123354_104204272 247
77 3300041968 Ga0456237_0008522 Ga0456237_0008522_222_965 247
78 3300042591 Ga0466692_069907 Ga0466692_069907_846_1589 247
79 3300042619 Ga0466726_433112 Ga0466726_433112_561_1304 247
80 3300010049 Ga0123356_10502613 Ga0123356_105026132 248
81 3300010049 Ga0123356_10808635 Ga0123356_108086352 248
82 3300042598 Ga0466701_043274 Ga0466701_043274_182_928 248
83 3300042624 Ga0466735_142440 Ga0466735_142440_1994_2740 248
84 3300042659 Ga0466733_012094 Ga0466733_012094_389_1135 248
85 3300042622 Ga0466731_253896 Ga0466731_253896_416_1165 249
86 iso_pr_bacteria 2820267566 2820269972 249
87 3300010167 Ga0123353_10027320 Ga0123353_100273202 250
88 3300010167 Ga0123353_10691068 Ga0123353_106910682 250
89 3300002504 JGI24705J35276_12223574 JGI24705J35276_122235743 251
90 3300038395 Ga0415639_077284 Ga0415639_077284_88_852 254
91 3300042601 Ga0466707_351852 Ga0466707_351852_2343_3110 255
92 3300042619 Ga0466726_105607 Ga0466726_105607_2843_3610 255
93 3300042636 Ga0466703_200655 Ga0466703_200655_1208_1975 255
94 3300042655 Ga0466727_039508 Ga0466727_039508_204_971 255
95 3300042659 Ga0466733_159567 Ga0466733_159567_224_991 255
96 3300042593 Ga0466691_177072 Ga0466691_177072_274_1044 256
97 3300042606 Ga0466719_178000 Ga0466719_178000_2276_3046 256
98 3300042606 Ga0466719_423876 Ga0466719_423876_1240_2010 256
99 iso_pr_bacteria 650716099 650877700 256
100 3300042590 Ga0466690_009127 Ga0466690_009127_1383_2159 258
101 3300042593 Ga0466691_199020 Ga0466691_199020_1089_1865 258
102 3300042606 Ga0466719_221593 Ga0466719_221593_4109_4885 258
103 3300042612 Ga0466705_443902 Ga0466705_443902_246_1022 258
104 3300042619 Ga0466726_162097 Ga0466726_162097_141_917 258
105 3300042636 Ga0466703_151321 Ga0466703_151321_4081_4857 258
106 3300042643 Ga0466704_154549 Ga0466704_154549_19192_19968 258
107 3300042655 Ga0466727_001217 Ga0466727_001217_60_836 258
108 3300042655 Ga0466727_129586 Ga0466727_129586_983_1759 258
109 3300042655 Ga0466727_266548 Ga0466727_266548_1252_2028 258
110 3300042590 Ga0466690_059556 Ga0466690_059556_113_892 259
111 3300042593 Ga0466691_052044 Ga0466691_052044_10644_11423 259
112 3300042596 Ga0466696_157311 Ga0466696_157311_4508_5287 259
113 3300042596 Ga0466696_179610 Ga0466696_179610_1637_2416 259
114 3300042596 Ga0466696_238986 Ga0466696_238986_1113_1892 259
115 3300042606 Ga0466719_388875 Ga0466719_388875_197_976 259
116 3300042612 Ga0466705_049050 Ga0466705_049050_734_1513 259
117 3300042612 Ga0466705_217315 Ga0466705_217315_2537_3316 259
118 3300042618 Ga0466723_146583 Ga0466723_146583_2017_2796 259
119 3300042618 Ga0466723_240466 Ga0466723_240466_7828_8607 259
120 3300042618 Ga0466723_254832 Ga0466723_254832_7889_8668 259
121 3300042620 Ga0466728_062721 Ga0466728_062721_1723_2502 259
122 3300042636 Ga0466703_041775 Ga0466703_041775_6183_6962 259
123 3300042636 Ga0466703_051734 Ga0466703_051734_2579_3358 259
124 3300042643 Ga0466704_019245 Ga0466704_019245_379_1158 259
125 3300042643 Ga0466704_464040 Ga0466704_464040_952_1731 259
126 3300042648 Ga0466709_009097 Ga0466709_009097_5538_6317 259
127 3300042652 Ga0466708_047798 Ga0466708_047798_692_1471 259
128 3300042652 Ga0466708_271808 Ga0466708_271808_2637_3416 259
129 3300042655 Ga0466727_153418 Ga0466727_153418_681_1460 259
130 3300042655 Ga0466727_283679 Ga0466727_283679_369_1148 259
131 3300042606 Ga0466719_029177 Ga0466719_029177_475_1260 261
132 3300042619 Ga0466726_318983 Ga0466726_318983_469_1254 261
133 3300042619 Ga0466726_438498 Ga0466726_438498_58_843 261
134 3300042636 Ga0466703_009474 Ga0466703_009474_3957_4742 261
135 3300042655 Ga0466727_106293 Ga0466727_106293_235_1020 261
136 3300042655 Ga0466727_241335 Ga0466727_241335_4275_5060 261
137 3300042621 Ga0466729_216908 Ga0466729_216908_10849_11664 271
138 3300042619 Ga0466726_310071 Ga0466726_310071_4715_5536 273

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF06283 ThuA Trehalose utilisation 20 237 0.79

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.9 0.97 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.