Protein Family IF08286

Metagenome Metatranscriptome Isolate
356 Members
202 Samples
242 Scaffolds
409.78 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_266592|Ga0466726_266592_922_2352
Length
476 aa
Sequence
MFHKHIRKKTARENRQPPPLFKGKVFCYAANPPPPLALSACSGGLVLFPAPXPLSLITQTEMKIVLAYSGGLDTSVIVKWLRETYDAEIITFAADLGQEEELKGLDKKARATGASKHYTLDLVEDFARDYIFPMVRANAIYEGQYYLGTSIARPLIAKAQVEIARKEKADTVAHGATGKGNDQCRFELSYMALAPRLNIVAPWKIEAFREQFPGRAEMIAYCQKHQIPVEASLKKPYSMDRNLLHISYEAGILEDPWFDPTVAKNKDMFKLSVSPEDAPDKPEFVEIEFLKGDAVAVNGKQLTPGALLRALNKLGGKHGIGRVDIVENRFVGMKSRGVYETPGGTILTHAHRQVETLTLDRDLEHLRDTLVPKYAELIYNGFWFAPEREALQAFIDKSQEFVTGTVRLKLYKGNIITCGRKSPYSLYNESVASMEGVESDYNQSDAVGFIRLNGLRLRARAHAQGAPKYAPIKALK

📊 Sample Types

Isolate 32.0%
Metagenome 66.3%
MAG 0.0%
Metatranscriptome 1.7%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 32.1%
Termitidae 16.3%
Coreidae 14.8%
Formicidae 7.1%
Blattidae 6.6%
Kalotermitidae 6.6%
Tenebrionidae 3.1%
Rhinotermitidae 2.0%
Termopsidae 2.0%
Passalidae 1.5%
Culicidae 1.5%
Elmidae 1.5%
Apidae 1.0%
Armadillidiidae 0.5%
Hodotermitidae 0.5%
Aleyrodidae 0.5%
Scarabaeidae 0.5%
Alydidae 0.5%
Kiwaidae 0.5%
Noctuidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 327
Eukaryota 0
Viruses 0
Unclassified 29

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
2 2940241992 Fusobacterium sp. PH5-29 Isolate Blattidae
3 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
4 2820907832 Unclassified Actinobacteria Emb289P4bin29 Isolate Unclassified
5 2778260937 Unclassified Fibrobacteres Co191P3bin40 Isolate Unclassified
6 2820047982 Unclassified Proteobacteria Th196P3bin67 Isolate Unclassified
7 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
8 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
9 2820716747 Unclassified Fibrobacteres Nc150P3bin18 Isolate Unclassified
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
12 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
13 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
14 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
15 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
16 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
17 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
18 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
19 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
20 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
21 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
22 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
23 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
24 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
25 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
26 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
27 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
28 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
29 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
30 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
31 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
32 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
33 2848339753 Ephemeroptericola cinctiostellae F02 Isolate Unclassified
34 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
35 2940377351 Ereboglobus sp. PH5-5 Isolate Blattidae
36 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
37 2518285589 Candidatus Portiera aleyrodidarum TV (unscreened) Isolate Aleyrodidae
38 2740892545 Fibrobacteria bacterium GUT31 IN01_31 Isolate Unclassified
39 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
40 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
41 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
42 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
43 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
44 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
45 2820301196 Unclassified Firmicutes Th196P1bin8 Isolate Unclassified
46 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
47 2820569216 Unclassified Firmicutes Emb289P3bin33 Isolate Unclassified
48 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
49 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
50 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
51 3300060759 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_oats_a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
52 3300060766 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_LDPE_b (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
53 3300060772 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
54 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
55 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
56 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
57 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
58 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
59 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
60 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
61 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
62 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
63 2864755708 Massilia timonae S00006 Isolate Elmidae
64 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
65 2508501067 Opitutaceae bacterium TAV1 Isolate Unclassified
66 2639763186 Opitutaceae bacterium TAV4 Isolate Unclassified
67 2820065746 Unclassified Proteobacteria Nt197P3bin56 Isolate Unclassified
68 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
69 2820242869 Unclassified Firmicutes Th196P3bin82 Isolate Unclassified
70 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
71 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
72 2820714932 Unclassified Fibrobacteres Nc150P4bin10 Isolate Unclassified
73 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
74 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
75 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
76 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
77 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
78 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
79 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
80 3300060706 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Day0a (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
81 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
82 3300006995 Ant gut microbial communities from Cephalotes angustus, Brazil Metagenome Formicidae
83 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
84 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
85 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
86 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
87 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
88 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
89 2603880164 Opitutus sp. Isolate Formicidae
90 2773857779 Unclassified Fibrobacteres Co191P1bin69 Isolate Unclassified
91 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
92 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
93 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
94 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
95 8069748016 Caballeronia sp. LP003 Isolate Coreidae
96 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
97 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
98 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
99 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
100 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
101 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
102 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
103 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
104 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
105 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
106 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
107 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
108 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
109 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
110 2820942695 Unclassified Actinobacteria Cu122P5bin37 Isolate Unclassified
111 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
112 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
113 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
114 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
115 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
116 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
117 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
118 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
119 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
120 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
121 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
122 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
123 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
124 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
125 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
126 2857498920 Opitutaceae bacterium TAV4 Isolate Unclassified
127 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
128 2940239174 Ereboglobus sp. PH5-10 Isolate Blattidae
129 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
130 2517572100 Geminisphaera colitermitum TAV2 Isolate Unclassified
131 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
132 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
133 2740892546 Fibrobacteria bacterium GUT307 IN01_307 Isolate Unclassified
134 2778260939 Unclassified Fibrobacteres Co191P4bin13 Isolate Unclassified
135 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
136 2820027804 Unclassified Spirochaetes Lab288P1bin105 Isolate Unclassified
137 2820071837 Unclassified Proteobacteria Nt197P3bin132 Isolate Unclassified
138 2820152154 Unclassified Proteobacteria Cu122P5bin47 Isolate Unclassified
139 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
140 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
141 2820296961 Unclassified Firmicutes Th196P3bin102 Isolate Unclassified
142 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
143 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
144 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
145 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
146 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
147 3300060775 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_oats_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
148 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
149 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
150 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
151 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
152 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
153 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae
154 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
155 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
156 2639763185 Opitutaceae bacterium TAV3 Isolate Unclassified
157 2706794701 Opitutaceae bacterium TSB47 Isolate Rhinotermitidae
158 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
159 2820110010 Unclassified Proteobacteria Emb289P4bin35 Isolate Unclassified
160 2687453757 Opitutus sp. Cag34 Isolate Unclassified
161 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
162 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
163 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
164 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
165 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
166 3300060756 Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_HDPE_oats_c (Metagenome Metatranscriptome) Metatranscriptome Tenebrionidae
167 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
168 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
169 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
170 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
171 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
172 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
173 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
174 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
175 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
176 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
177 2820833147 Unclassified Actinobacteria Lab288P4bin85 Isolate Unclassified
178 2821322763 Unclassified Actinobacteria Cu122P5bin19 Isolate Unclassified
179 2857493320 Opitutaceae bacterium TAV3 Isolate Unclassified
180 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
181 2940349480 Fusobacterium sp. PH5-44 Isolate Blattidae
182 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
183 2820001644 Unclassified Synergistetes Th196P3bin106 Isolate Unclassified
184 2820042117 Unclassified Proteobacteria Th196P4bin58 Isolate Unclassified
185 2820050117 Unclassified Proteobacteria Th196P3bin129 Isolate Unclassified
186 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
187 2820132692 Unclassified Proteobacteria Emb289P3bin76 Isolate Unclassified
188 2820263778 Unclassified Firmicutes Th196P3bin37 Isolate Unclassified
189 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
190 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
191 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
192 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
193 8102131453 Caballeronia sp. INML5 Isolate Coreidae
194 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
195 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
196 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
197 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
198 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
199 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
200 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
201 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
202 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_158674 3300042601 Bacteria 2301
2 Ga0466707_235890 3300042601 Bacteria 12778
3 Ga0466713_118697 3300042602 Bacteria 3070
4 Ga0466717_170903 3300042604 Bacteria 6039
5 Ga0123355_10135972 3300009826 Bacteria 3775
6 Ga0123353_10026987 3300010167 Bacteria 8789
7 Ga0123354_10100685 3300010882 Bacteria 3909
8 Ga0123354_10207393 3300010882 Bacteria 2131
9 Ga0160467_100168 3300012829 Bacteria 90362
10 Ga0264413_105432 3300024493 Unclassified 4161
11 Ga0466712_012580 3300042614 Bacteria 15444
12 Ga0466712_045057 3300042614 Bacteria 7547
13 Ga0466712_087251 3300042614 Bacteria 35550
14 Ga0466726_058934 3300042619 Bacteria 8888
15 Ga0466726_218918 3300042619 Bacteria 3906
16 Ga0466726_243467 3300042619 Bacteria 21627
17 Ga0466729_246118 3300042621 Bacteria 2445
18 Ga0466703_023677 3300042636 Bacteria 8376
19 Ga0466704_508939 3300042643 Bacteria 12922
20 Ga0466724_43356 3300042649 Bacteria 3586
21 Ga0466708_201306 3300042652 Bacteria 23547
22 Ga0466725_114107 3300042654 Bacteria 39880
23 IMNBGM34_c005869 3300000036 Bacteria 1609
24 AustNasuHG_c1001679 3300000089 Unclassified 7986
25 JGI24695J34938_10000273 3300002450 Bacteria 50542
26 JGI24695J34938_10025770 3300002450 Bacteria 2805
27 Ga0072941_1024312 3300005201 Bacteria 7726
28 Ga0103260_1000030 3300007139 Bacteria 66904
29 Ga0466705_148940 3300042612 Bacteria 2505
30 Ga0466733_096684 3300042659 Bacteria 2031
31 Ga0466733_163075 3300042659 Bacteria 1506
32 Ga0466706_123989 3300042599 Bacteria 3324
33 Ga0466714_084828 3300042603 Bacteria 27281
34 Ga0466719_195650 3300042606 Bacteria 4576
35 Ga0466720_089404 3300042607 Bacteria 54525
36 Ga0123353_10000496 3300010167 Bacteria 48699
37 Ga0123354_10000141 3300010882 Bacteria 55442
38 Ga0160454_100024 3300012798 Bacteria 291152
39 Ga0160465_102685 3300012803 Bacteria 3697
40 Ga0160464_100644 3300012805 Bacteria 21664
41 Ga0466657_083943 3300042582 Bacteria 5735
42 Ga0466690_089787 3300042590 Bacteria 5762
43 Ga0466692_161678 3300042591 Bacteria 2743
44 Ga0466694_095164 3300042594 Bacteria 8956
45 Ga0466699_023029 3300042597 Bacteria 14630
46 Ga0466712_018061 3300042614 Bacteria 22423
47 Ga0466711_259965 3300042615 Bacteria 12270
48 Ga0466715_090705 3300042616 Bacteria 1874
49 Ga0466715_244824 3300042616 Bacteria 35894
50 Ga0466718_133967 3300042617 Unclassified 12107
51 Ga0466723_039589 3300042618 Bacteria 11826
52 Ga0466723_133803 3300042618 Bacteria 8507
53 Ga0466726_266592 3300042619 Bacteria 2365
54 Ga0466729_128303 3300042621 Unclassified 2687
55 Ga0466734_001285 3300042623 Bacteria 6253
56 Ga0466703_131665 3300042636 Bacteria 21166
57 Ga0466703_281109 3300042636 Bacteria 4185
58 Ga0466703_389820 3300042636 Bacteria 23947
59 Ga0466708_179569 3300042652 Bacteria 21735
60 Ga0466727_282815 3300042655 Bacteria 14787
61 Ga0466727_294815 3300042655 Bacteria 6831
62 IMNBL1DRAFT_c0000287 3300000062 Bacteria 44153
63 Ga0072941_1013063 3300005201 Bacteria 88760
64 Ga0102739_1000126 3300007095 Unclassified 28568
65 Ga0102737_1000633 3300007142 Unclassified 11470
66 Ga0466733_080847 3300042659 Bacteria 30122
67 Ga0590815_01201 3300060706 Unclassified 4099
68 Ga0590799_05227 3300060775 Unclassified 1409
69 Ga0466706_025250 3300042599 Bacteria 6630
70 Ga0466706_094005 3300042599 Bacteria 26377
71 Ga0466706_204759 3300042599 Bacteria 1996
72 Ga0466707_105188 3300042601 Bacteria 18720
73 Ga0466720_083162 3300042607 Bacteria 29596
74 Ga0123353_10004716 3300010167 Bacteria 17651
75 Ga0123353_10105506 3300010167 Bacteria 4541
76 Ga0123353_10157817 3300010167 Bacteria 3614
77 Ga0160467_100291 3300012829 Bacteria 58363
78 Ga0160434_102298 3300012850 Bacteria 3332
79 Ga0466690_090551 3300042590 Bacteria 20377
80 Ga0466690_136970 3300042590 Bacteria 10441
81 Ga0466693_355563 3300042592 Bacteria 1944
82 Ga0466691_027648 3300042593 Bacteria 8366
83 Ga0466691_127107 3300042593 Bacteria 3387
84 Ga0466691_171516 3300042593 Bacteria 7530
85 Ga0466694_004720 3300042594 Bacteria 8651
86 Ga0466696_414157 3300042596 Unclassified 5088
87 Ga0466711_197867 3300042615 Bacteria 6114
88 Ga0466718_057720 3300042617 Bacteria 6150
89 Ga0466718_091226 3300042617 Bacteria 18188
90 Ga0466726_310288 3300042619 Bacteria 1981
91 Ga0466729_273882 3300042621 Bacteria 8624
92 Ga0466704_117704 3300042643 Bacteria 3193
93 Ga0466708_106595 3300042652 Bacteria 59435
94 Ga0466727_042477 3300042655 Bacteria 75148
95 Ga0466727_044140 3300042655 Bacteria 29656
96 IMNBL1DRAFT_c0004397 3300000062 Bacteria 8495
97 IMNBL1DRAFT_c0006089 3300000062 Bacteria 6700
98 AustNasuHG_c1026128 3300000089 Bacteria 1823
99 JGI24698J34947_10053700 3300002449 Bacteria 2015
100 JGI24699J35502_11098928 3300002509 Unclassified 2307
101 Ga0068305_10041510 3300005083 Bacteria 11430
102 Ga0072941_1013067 3300005201 Bacteria 7870
103 Ga0072941_1024258 3300005201 Bacteria 20119
104 Ga0072941_1033709 3300005201 Unclassified 11654
105 Ga0102737_1000519 3300007142 Unclassified 12587
106 Ga0466705_235757 3300042612 Bacteria 80436
107 Ga0466705_382111 3300042612 Bacteria 4352
108 Ga0466732_232028 3300042656 Bacteria 12386
109 Ga0466733_025063 3300042659 Bacteria 7282
110 Ga0466706_055045 3300042599 Bacteria 47604
111 Ga0466713_116118 3300042602 Bacteria 14615
112 Ga0466714_138634 3300042603 Bacteria 2550
113 Ga0466720_027770 3300042607 Bacteria 36910
114 Ga0466720_045361 3300042607 Bacteria 101316
115 Ga0123357_10234380 3300009784 Bacteria 2003
116 Ga0123356_10305492 3300010049 Bacteria 1698
117 Ga0123353_10000427 3300010167 Bacteria 52047
118 Ga0123354_10005586 3300010882 Bacteria 18341
119 Ga0264413_105364 3300024493 Bacteria 3479
120 Ga0415639_096143 3300038395 Bacteria 5002
121 Ga0466694_383070 3300042594 Bacteria 2635
122 Ga0466696_220453 3300042596 Bacteria 48351
123 Ga0466710_048462 3300042613 Bacteria 24970
124 Ga0466715_084546 3300042616 Bacteria 2770
125 Ga0466718_061397 3300042617 Bacteria 11265
126 Ga0466729_206171 3300042621 Bacteria 17094
127 Ga0466734_014574 3300042623 Bacteria 37917
128 Ga0466704_179516 3300042643 Bacteria 6978
129 2227164158 2225789004 Bacteria 8319
130 2227425263 2225789004 Bacteria 5592
131 IMNBGM34_c000118 3300000036 Bacteria 22722
132 JGI24698J34947_10003622 3300002449 Bacteria 8394
133 JGI24698J34947_10004957 3300002449 Unclassified 7297
134 Ga0072941_1000435 3300005201 Bacteria 27493
135 Ga0072941_1012232 3300005201 Bacteria 35231
136 Ga0072941_1132255 3300005201 Bacteria 1902
137 Ga0123357_10000290 3300009784 Bacteria 48139
138 Ga0123357_10002835 3300009784 Bacteria 19560
139 Ga0590772_00643 3300060756 Unclassified 4233
140 Ga0590776_00692 3300060759 Unclassified 4048
141 Ga0466722_046563 3300042609 Bacteria 7180
142 Ga0466722_178076 3300042609 Bacteria 16801
143 Ga0123357_10004916 3300009784 Bacteria 15854
144 Ga0123355_10094159 3300009826 Bacteria 4740
145 Ga0123354_10004840 3300010882 Unclassified 19276
146 Ga0123354_10175375 3300010882 Bacteria 2474
147 Ga0466692_053051 3300042591 Bacteria 75912
148 Ga0466695_370903 3300042595 Bacteria 6546
149 Ga0466710_040430 3300042613 Bacteria 27544
150 Ga0466715_307818 3300042616 Bacteria 58612
151 Ga0466715_420607 3300042616 Bacteria 23596
152 Ga0466726_065034 3300042619 Bacteria 18494
153 Ga0466728_190681 3300042620 Bacteria 53550
154 Ga0466734_128029 3300042623 Bacteria 9199
155 Ga0466735_220976 3300042624 Unclassified 5871
156 Ga0466725_023112 3300042654 Bacteria 48186
157 IMNBL1DRAFT_c0001190 3300000062 Bacteria 19769
158 CVPL005W_1001479 3300002934 Unclassified 15404
159 Ga0068305_10052701 3300005083 Bacteria 4515
160 Ga0102733_100024 3300006995 Bacteria 31052
161 Ga0103263_100013 3300007042 Bacteria 45098
162 Ga0102735_1000072 3300007080 Bacteria 50908
163 Ga0103261_1000005 3300007083 Bacteria 157552
164 Ga0466705_061380 3300042612 Bacteria 26546
165 Ga0466705_137351 3300042612 Bacteria 8160
166 Ga0590796_00500 3300060772 Unclassified 3939
167 Ga0466713_064626 3300042602 Bacteria 8840
168 Ga0466719_030078 3300042606 Bacteria 26685
169 Ga0466722_095550 3300042609 Bacteria 25610
170 Ga0123357_10010740 3300009784 Bacteria 11675
171 Ga0123356_10010068 3300010049 Bacteria 9297
172 Ga0160470_100040 3300012813 Bacteria 196297
173 Ga0157631_101228 3300013007 Bacteria 14234
174 Ga0466657_224296 3300042582 Unclassified 3974
175 Ga0466692_156686 3300042591 Bacteria 117611
176 Ga0466694_150487 3300042594 Bacteria 18585
177 Ga0466701_009668 3300042598 Bacteria 4119
178 Ga0466715_051052 3300042616 Bacteria 2583
179 Ga0466715_420539 3300042616 Bacteria 1362
180 Ga0466718_167671 3300042617 Bacteria 16721
181 Ga0466735_094867 3300042624 Bacteria 3268
182 Ga0466704_060201 3300042643 Bacteria 120850
183 Ga0466704_425493 3300042643 Bacteria 6690
184 Ga0123357_10001076 3300009784 Bacteria 28163
185 Ga0590789_03731 3300060766 Bacteria 1346
186 Ga0466707_054027 3300042601 Bacteria 1292
187 Ga0466707_144148 3300042601 Bacteria 33317
188 Ga0466717_092404 3300042604 Bacteria 6591
189 Ga0466722_131972 3300042609 Unclassified 1556
190 Ga0466722_133214 3300042609 Bacteria 21790
191 Ga0123357_10010678 3300009784 Bacteria 11703
192 Ga0123357_10172619 3300009784 Bacteria 2552
193 Ga0160471_101246 3300012812 Unclassified 5306
194 Ga0160453_100688 3300012814 Bacteria 20595
195 Ga0466657_044496 3300042582 Bacteria 106333
196 Ga0466692_049282 3300042591 Bacteria 249845
197 Ga0466695_321851 3300042595 Bacteria 6864
198 Ga0466696_096221 3300042596 Bacteria 4011
199 Ga0466710_213729 3300042613 Bacteria 1785
200 Ga0466715_044373 3300042616 Bacteria 3969
201 Ga0466704_168434 3300042643 Bacteria 9403
202 Ga0466725_093035 3300042654 Bacteria 14494
203 Ga0466725_293742 3300042654 Bacteria 19643
204 Ga0466727_035377 3300042655 Bacteria 1914
205 IMNBGM34_c000347 3300000036 Bacteria 13318
206 JGI24695J34938_10044587 3300002450 Bacteria 1972
207 JGI24702J35022_10017384 3300002462 Bacteria 3930
208 JGI24700J35501_10924400 3300002508 Bacteria 5463
209 Ga0102736_1000005 3300007052 Bacteria 101322
210 Ga0103266_1000020 3300007067 Unclassified 84543
211 Ga0103265_1001587 3300007068 Unclassified 9970
212 Ga0102734_1000108 3300007129 Bacteria 31109
213 Ga0102738_1000029 3300007141 Bacteria 100132
214 Ga0123357_10000234 3300009784 Bacteria 52576
215 Ga0466701_034356 3300042598 Bacteria 72007
216 Ga0466713_071200 3300042602 Bacteria 26671
217 Ga0466716_309995 3300042605 Bacteria 6243
218 Ga0466716_312493 3300042605 Bacteria 3164
219 Ga0466722_192812 3300042609 Bacteria 4738
220 Ga0123356_10052506 3300010049 Unclassified 3792
221 Ga0123353_10123295 3300010167 Bacteria 4165
222 Ga0264413_100816 3300024493 Unclassified 20524
223 Ga0264413_101854 3300024493 Unclassified 2634
224 Ga0466692_096389 3300042591 Bacteria 111541
225 Ga0466693_424769 3300042592 Bacteria 2219
226 Ga0466691_026078 3300042593 Unclassified 20831
227 Ga0466694_261055 3300042594 Unclassified 2355
228 Ga0466696_073796 3300042596 Bacteria 10978
229 Ga0466699_234959 3300042597 Bacteria 5630
230 Ga0466710_057631 3300042613 Bacteria 1730
231 Ga0466710_166744 3300042613 Bacteria 2226
232 Ga0466711_296459 3300042615 Bacteria 5489
233 Ga0466735_125212 3300042624 Bacteria 3966
234 Ga0466735_142629 3300042624 Bacteria 15378
235 Ga0466702_218059 3300042635 Bacteria 2657
236 Ga0466708_319577 3300042652 Bacteria 8636
237 Ga0466727_126543 3300042655 Bacteria 3763
238 Ga0466727_191545 3300042655 Bacteria 4389
239 2227558263 2225789004 Bacteria 2756
240 JGI24696J40584_12958665 3300002834 Bacteria 4312
241 Ga0068302_10038251 3300005071 Bacteria 5624
242 Ga0072941_1025224 3300005201 Bacteria 16924

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2820573558 2820576354 351
2 iso_pr_bacteria 2820042117 2820044262 352
3 3300042616 Ga0466715_084546 Ga0466715_084546_1685_2746 353
4 3300042621 Ga0466729_246118 Ga0466729_246118_1116_2225 369
5 iso_pr_bacteria 2820152154 2820154624 372
6 iso_pr_bacteria 2778260937 2778349087 373
7 3300009784 Ga0123357_10172619 Ga0123357_101726192 386
8 3300042613 Ga0466710_213729 Ga0466710_213729_605_1771 388
9 3300009784 Ga0123357_10002835 Ga0123357_1000283511 389
10 3300042613 Ga0466710_057631 Ga0466710_057631_15_1187 390
11 3300005083 Ga0068305_10041510 Ga0068305_100415104 392
12 3300042624 Ga0466735_125212 Ga0466735_125212_720_1898 392
13 3300042618 Ga0466723_039589 Ga0466723_039589_5843_7075 395
14 3300042612 Ga0466705_061380 Ga0466705_061380_11213_12406 397
15 3300042643 Ga0466704_508939 Ga0466704_508939_4915_6108 397
16 3300042649 Ga0466724_43356 Ga0466724_43356_276_1469 397
17 3300042595 Ga0466695_321851 Ga0466695_321851_4550_5746 398
18 3300042619 Ga0466726_243467 Ga0466726_243467_409_1605 398
19 3300042655 Ga0466727_126543 Ga0466727_126543_158_1354 398
20 3300009784 Ga0123357_10234380 Ga0123357_102343802 399
21 2225789004 2227425263 2227865774 400
22 3300010882 Ga0123354_10175375 Ga0123354_101753752 400
23 3300042615 Ga0466711_259965 Ga0466711_259965_7965_9191 400
24 3300024493 Ga0264413_105432 Ga0264413_1054322 401
25 3300042601 Ga0466707_054027 Ga0466707_054027_20_1225 401
26 3300042601 Ga0466707_144148 Ga0466707_144148_18754_19959 401
27 3300042601 Ga0466707_235890 Ga0466707_235890_1474_2679 401
28 3300042609 Ga0466722_178076 Ga0466722_178076_14375_15595 401
29 3300042643 Ga0466704_168434 Ga0466704_168434_3858_5063 401
30 iso_pr_bacteria 2820673891 2820674720 401
31 iso_pr_bacteria 2820685979 2820686191 401
32 3300002450 JGI24695J34938_10000273 JGI24695J34938_1000027310 402
33 3300042592 Ga0466693_355563 Ga0466693_355563_460_1668 402
34 3300042592 Ga0466693_424769 Ga0466693_424769_176_1384 402
35 3300042596 Ga0466696_220453 Ga0466696_220453_33498_34706 402
36 iso_pr_bacteria 2781125694 2781436829 402
37 iso_pr_bacteria 2819994798 2819995306 402
38 iso_pr_bacteria 2820263778 2820265154 402
39 iso_pr_bacteria 2820275298 2820276140 402
40 iso_pr_bacteria 2820292184 2820292423 402
41 2225789004 2227164158 2227575851 403
42 3300000062 IMNBL1DRAFT_c0006089 IMNBL1DRAFT_00060895 403
43 3300002508 JGI24700J35501_10924400 JGI24700J35501_109244004 403
44 3300042597 Ga0466699_234959 Ga0466699_234959_1093_2304 403
45 3300042599 Ga0466706_025250 Ga0466706_025250_2313_3524 403
46 3300042659 Ga0466733_025063 Ga0466733_025063_5975_7186 403
47 3300042659 Ga0466733_096684 Ga0466733_096684_474_1685 403
48 iso_pr_bacteria 2820296961 2820297222 403
49 iso_pr_bacteria 2940241992 2940244239 403
50 iso_pr_bacteria 2940349480 2940351723 403
51 3300000062 IMNBL1DRAFT_c0000287 IMNBL1DRAFT_000028711 404
52 3300000062 IMNBL1DRAFT_c0004397 IMNBL1DRAFT_00043973 404
53 3300009826 Ga0123355_10094159 Ga0123355_100941593 404
54 3300010167 Ga0123353_10123295 Ga0123353_101232953 404
55 3300042591 Ga0466692_049282 Ga0466692_049282_65772_66989 405
56 3300042594 Ga0466694_261055 Ga0466694_261055_518_1735 405
57 3300042621 Ga0466729_206171 Ga0466729_206171_11078_12295 405
58 3300042652 Ga0466708_179569 Ga0466708_179569_20478_21695 405
59 3300042656 Ga0466732_232028 Ga0466732_232028_9992_11209 405
60 iso_pr_bacteria 2518285589 2518564916 405
61 iso_pr_bacteria 2603880164 2606012193 405
62 iso_pr_bacteria 2820110010 2820110314 405
63 iso_pr_bacteria 2820244222 2820246456 405
64 iso_pr_bacteria 2820833147 2820833837 405
65 iso_pr_bacteria 2820907832 2820908889 405
66 iso_pr_bacteria 2820942695 2820943545 405
67 iso_pr_bacteria 2821322763 2821323016 405
68 iso_pr_bacteria 2864808494 2864808541 405
69 iso_pr_bacteria 2864812326 2864812373 405
70 3300002934 CVPL005W_1001479 CVPL005W_10014792 406
71 3300006995 Ga0102733_100024 Ga0102733_10002421 406
72 3300007042 Ga0103263_100013 Ga0103263_10001331 406
73 3300007067 Ga0103266_1000020 Ga0103266_100002011 406
74 3300007068 Ga0103265_1001587 Ga0103265_100158713 406
75 3300007083 Ga0103261_1000005 Ga0103261_1000005144 406
76 3300007095 Ga0102739_1000126 Ga0102739_100012624 406
77 3300007129 Ga0102734_1000108 Ga0102734_100010813 406
78 3300007139 Ga0103260_1000030 Ga0103260_100003036 406
79 3300007141 Ga0102738_1000029 Ga0102738_100002989 406
80 3300007142 Ga0102737_1000519 Ga0102737_10005193 406
81 3300007142 Ga0102737_1000633 Ga0102737_100063310 406
82 3300009784 Ga0123357_10010678 Ga0123357_100106785 406
83 3300009784 Ga0123357_10010740 Ga0123357_100107406 406
84 3300010167 Ga0123353_10004716 Ga0123353_1000471613 406
85 3300010882 Ga0123354_10000141 Ga0123354_1000014141 406
86 3300042599 Ga0466706_204759 Ga0466706_204759_195_1415 406
87 iso_pr_bacteria 2687453757 2690048413 406
88 iso_pr_bacteria 2781125690 2781427698 406
89 iso_pr_bacteria 2781125693 2781434306 406
90 iso_pr_bacteria 2820001644 2820002231 406
91 iso_pr_bacteria 2820267566 2820267888 406
92 3300000036 IMNBGM34_c005869 IMNBGM34_0058692 407
93 3300012814 Ga0160453_100688 Ga0160453_10068818 407
94 3300012829 Ga0160467_100168 Ga0160467_10016833 407
95 3300042594 Ga0466694_004720 Ga0466694_004720_4801_6024 407
96 3300042616 Ga0466715_044373 Ga0466715_044373_1885_3108 407
97 iso_pr_bacteria 2820336130 2820338297 407
98 3300007080 Ga0102735_1000072 Ga0102735_10000728 408
99 3300010167 Ga0123353_10000427 Ga0123353_100004277 408
100 3300010167 Ga0123353_10157817 Ga0123353_101578173 408
101 3300042596 Ga0466696_073796 Ga0466696_073796_4805_6031 408
102 3300042602 Ga0466713_064626 Ga0466713_064626_7292_8584 408
103 3300042612 Ga0466705_382111 Ga0466705_382111_2925_4151 408
104 3300042616 Ga0466715_090705 Ga0466715_090705_507_1733 408
105 3300042616 Ga0466715_420539 Ga0466715_420539_65_1291 408
106 3300042619 Ga0466726_218918 Ga0466726_218918_2489_3715 408
107 3300042636 Ga0466703_023677 Ga0466703_023677_5089_6315 408
108 3300042643 Ga0466704_179516 Ga0466704_179516_2198_3424 408
109 3300042643 Ga0466704_425493 Ga0466704_425493_5309_6535 408
110 3300042652 Ga0466708_201306 Ga0466708_201306_14567_15889 408
111 3300042654 Ga0466725_293742 Ga0466725_293742_12703_13929 408
112 iso_pr_bacteria 2508501067 2508837423 408
113 iso_pr_bacteria 2517572100 2517758728 408
114 iso_pr_bacteria 2639763185 2642343304 408
115 iso_pr_bacteria 2639763186 2642350934 408
116 iso_pr_bacteria 2820272499 2820272885 408
117 iso_pr_bacteria 2857493320 2857498423 408
118 iso_pr_bacteria 2857498920 2857503934 408
119 iso_pr_bacteria 2940239174 2940240796 408
120 iso_pr_bacteria 2940377351 2940378685 408
121 3300000036 IMNBGM34_c000118 IMNBGM34_0001184 409
122 3300013007 Ga0157631_101228 Ga0157631_1012289 409
123 3300042591 Ga0466692_161678 Ga0466692_161678_871_2100 409
124 3300042593 Ga0466691_171516 Ga0466691_171516_4500_5729 409
125 3300042599 Ga0466706_094005 Ga0466706_094005_14527_15756 409
126 3300042602 Ga0466713_118697 Ga0466713_118697_1460_2689 409
127 3300042613 Ga0466710_166744 Ga0466710_166744_899_2128 409
128 3300042614 Ga0466712_045057 Ga0466712_045057_4334_5563 409
129 3300042616 Ga0466715_244824 Ga0466715_244824_13779_15008 409
130 3300042617 Ga0466718_057720 Ga0466718_057720_4575_5804 409
131 3300042619 Ga0466726_058934 Ga0466726_058934_7176_8405 409
132 3300042621 Ga0466729_128303 Ga0466729_128303_838_2067 409
133 3300042636 Ga0466703_131665 Ga0466703_131665_3352_4581 409
134 3300042652 Ga0466708_106595 Ga0466708_106595_57226_58455 409
135 3300042652 Ga0466708_319577 Ga0466708_319577_4981_6210 409
136 3300042654 Ga0466725_114107 Ga0466725_114107_24353_25582 409
137 3300042655 Ga0466727_042477 Ga0466727_042477_60640_61869 409
138 3300060706 Ga0590815_01201 Ga0590815_01201_2786_4015 409
139 3300060756 Ga0590772_00643 Ga0590772_00643_129_1358 409
140 3300060759 Ga0590776_00692 Ga0590776_00692_31_1260 409
141 3300060772 Ga0590796_00500 Ga0590796_00500_34_1263 409
142 3300060775 Ga0590799_05227 Ga0590799_05227_58_1287 409
143 iso_pr_bacteria 2597489944 2598058305 409
144 iso_pr_bacteria 2820103659 2820105735 409
145 iso_pr_bacteria 2820123897 2820126795 409
146 iso_pr_bacteria 2820569216 2820569635 409
147 iso_pr_bacteria 2848339753 2848341604 409
148 iso_pr_bacteria 2852337885 2852341467 409
149 iso_pr_bacteria 2891720358 2891721652 409
150 iso_pr_bacteria 8024037630 8024039915 409
151 iso_pr_bacteria 8025708040 8025710418 409
152 iso_pr_bacteria 8025716094 8025718692 409
153 iso_pr_bacteria 8025740903 8025743033 409
154 iso_pr_bacteria 8069748016 8069749713 409
155 iso_pr_bacteria 8069763219 8069765349 409
156 iso_pr_bacteria 8078130113 8078132342 409
157 iso_pr_bacteria 8101951471 8101953690 409
158 iso_pr_bacteria 8101960468 8101962685 409
159 iso_pr_bacteria 8101967387 8101969603 409
160 iso_pr_bacteria 8101974301 8101976521 409
161 iso_pr_bacteria 8101981714 8101983960 409
162 iso_pr_bacteria 8101988189 8101990482 409
163 iso_pr_bacteria 8101994502 8101997027 409
164 iso_pr_bacteria 8102001125 8102003218 409
165 iso_pr_bacteria 8102007614 8102009815 409
166 iso_pr_bacteria 8102026984 8102029328 409
167 iso_pr_bacteria 8102033761 8102036612 409
168 iso_pr_bacteria 8102047609 8102050069 409
169 iso_pr_bacteria 8102067727 8102069993 409
170 iso_pr_bacteria 8102094248 8102096844 409
171 iso_pr_bacteria 8102131453 8102134195 409
172 iso_pr_bacteria 8102186987 8102189583 409
173 iso_pr_bacteria 8102193924 8102196301 409
174 iso_pr_bacteria 8102264549 8102266880 409
175 iso_pr_bacteria 8102271933 8102274363 409
176 iso_pr_bacteria 8102279326 8102281656 409
177 iso_pr_bacteria 8102286609 8102289024 409
178 iso_pr_bacteria 8102312426 8102318312 409
179 3300000036 IMNBGM34_c000347 IMNBGM34_0003475 410
180 3300000062 IMNBL1DRAFT_c0001190 IMNBL1DRAFT_000119015 410
181 3300002450 JGI24695J34938_10044587 JGI24695J34938_100445872 410
182 3300005071 Ga0068302_10038251 Ga0068302_100382515 410
183 3300009784 Ga0123357_10000234 Ga0123357_1000023436 410
184 3300009784 Ga0123357_10004916 Ga0123357_1000491610 410
185 3300010049 Ga0123356_10010068 Ga0123356_100100682 410
186 3300012812 Ga0160471_101246 Ga0160471_1012462 410
187 3300042582 Ga0466657_044496 Ga0466657_044496_43736_44968 410
188 3300042582 Ga0466657_083943 Ga0466657_083943_856_2088 410
189 3300042582 Ga0466657_224296 Ga0466657_224296_855_2087 410
190 3300042590 Ga0466690_089787 Ga0466690_089787_2614_3846 410
191 3300042590 Ga0466690_090551 Ga0466690_090551_624_1856 410
192 3300042590 Ga0466690_136970 Ga0466690_136970_607_1839 410
193 3300042591 Ga0466692_053051 Ga0466692_053051_65676_66908 410
194 3300042591 Ga0466692_156686 Ga0466692_156686_104471_105703 410
195 3300042593 Ga0466691_026078 Ga0466691_026078_2488_3720 410
196 3300042593 Ga0466691_127107 Ga0466691_127107_126_1358 410
197 3300042596 Ga0466696_096221 Ga0466696_096221_2018_3250 410
198 3300042596 Ga0466696_414157 Ga0466696_414157_1590_2822 410
199 3300042598 Ga0466701_034356 Ga0466701_034356_5267_6499 410
200 3300042601 Ga0466707_105188 Ga0466707_105188_2180_3412 410
201 3300042605 Ga0466716_312493 Ga0466716_312493_48_1280 410
202 3300042606 Ga0466719_030078 Ga0466719_030078_13001_14233 410
203 3300042609 Ga0466722_131972 Ga0466722_131972_207_1439 410
204 3300042612 Ga0466705_148940 Ga0466705_148940_155_1387 410
205 3300042612 Ga0466705_235757 Ga0466705_235757_4961_6193 410
206 3300042613 Ga0466710_040430 Ga0466710_040430_20003_21235 410
207 3300042613 Ga0466710_048462 Ga0466710_048462_21524_22756 410
208 3300042615 Ga0466711_197867 Ga0466711_197867_379_1611 410
209 3300042616 Ga0466715_051052 Ga0466715_051052_1197_2429 410
210 3300042619 Ga0466726_310288 Ga0466726_310288_55_1287 410
211 3300042620 Ga0466728_190681 Ga0466728_190681_50855_52087 410
212 3300042621 Ga0466729_273882 Ga0466729_273882_6800_8032 410
213 3300042623 Ga0466734_014574 Ga0466734_014574_4962_6194 410
214 3300042624 Ga0466735_094867 Ga0466735_094867_1096_2328 410
215 3300042635 Ga0466702_218059 Ga0466702_218059_305_1537 410
216 3300042643 Ga0466704_060201 Ga0466704_060201_20780_22012 410
217 3300042643 Ga0466704_117704 Ga0466704_117704_821_2053 410
218 3300042655 Ga0466727_191545 Ga0466727_191545_2122_3354 410
219 3300042659 Ga0466733_080847 Ga0466733_080847_24538_25770 410
220 iso_pr_bacteria 2528768159 2529053540 410
221 iso_pr_bacteria 2576861701 2579272908 410
222 iso_pr_bacteria 2706794701 2708047845 410
223 iso_pr_bacteria 2820047982 2820049670 410
224 iso_pr_bacteria 2820050117 2820051799 410
225 iso_pr_bacteria 2820065746 2820066256 410
226 iso_pr_bacteria 2820071837 2820072053 410
227 iso_pr_bacteria 2820089333 2820091204 410
228 iso_pr_bacteria 2820121232 2820121733 410
229 iso_pr_bacteria 2820132692 2820133843 410
230 iso_pr_bacteria 2820405014 2820406561 410
231 iso_pr_bacteria 2864755708 2864755747 410
232 3300002462 JGI24702J35022_10017384 JGI24702J35022_100173843 411
233 3300005201 Ga0072941_1025224 Ga0072941_102522419 411
234 3300010049 Ga0123356_10052506 Ga0123356_100525063 411
235 3300010167 Ga0123353_10026987 Ga0123353_100269871 411
236 3300010882 Ga0123354_10004840 Ga0123354_100048402 411
237 3300010882 Ga0123354_10100685 Ga0123354_101006852 411
238 3300012829 Ga0160467_100291 Ga0160467_10029119 411
239 3300042602 Ga0466713_116118 Ga0466713_116118_3893_5128 411
240 3300042604 Ga0466717_092404 Ga0466717_092404_3747_4982 411
241 3300042623 Ga0466734_001285 Ga0466734_001285_913_2148 411
242 3300042623 Ga0466734_128029 Ga0466734_128029_6181_7416 411
243 3300042636 Ga0466703_389820 Ga0466703_389820_20510_21745 411
244 iso_pr_bacteria 2551306396 2552921932 411
245 iso_pr_bacteria 2820084079 2820085865 411
246 iso_pr_bacteria 2820086750 2820088123 411
247 iso_pr_bacteria 2820332331 2820333607 411
248 iso_pr_bacteria 2940221333 2940224178 411
249 iso_pr_bacteria 2940380068 2940381226 411
250 iso_pr_bacteria 2940386776 2940387533 411
251 iso_pr_bacteria 2940393498 2940394657 411
252 iso_pr_bacteria 2940400224 2940401383 411
253 iso_pr_bacteria 2940406939 2940407814 411
254 iso_pr_bacteria 2940413413 2940416517 411
255 iso_pr_bacteria 2940419646 2940423082 411
256 iso_pr_bacteria 2940425923 2940429177 411
257 iso_pr_bacteria 2983866074 2983869487 411
258 3300010167 Ga0123353_10000496 Ga0123353_1000049628 412
259 3300010882 Ga0123354_10005586 Ga0123354_1000558619 412
260 3300012805 Ga0160464_100644 Ga0160464_1006446 412
261 3300012813 Ga0160470_100040 Ga0160470_100040160 412
262 3300042602 Ga0466713_071200 Ga0466713_071200_2605_3990 412
263 3300042655 Ga0466727_282815 Ga0466727_282815_11709_12947 412
264 iso_pr_bacteria 2820683647 2820684400 412
265 3300009784 Ga0123357_10000290 Ga0123357_100002903 413
266 3300009826 Ga0123355_10135972 Ga0123355_101359722 413
267 3300012798 Ga0160454_100024 Ga0160454_1000249 413
268 3300024493 Ga0264413_100816 Ga0264413_1008162 413
269 3300042591 Ga0466692_096389 Ga0466692_096389_29146_30387 413
270 3300042607 Ga0466720_083162 Ga0466720_083162_23120_24361 413
271 3300042607 Ga0466720_089404 Ga0466720_089404_46199_47440 413
272 3300042609 Ga0466722_192812 Ga0466722_192812_2162_3403 413
273 3300042624 Ga0466735_220976 Ga0466735_220976_76_1317 413
274 3300042654 Ga0466725_023112 Ga0466725_023112_7385_8626 413
275 3300042655 Ga0466727_035377 Ga0466727_035377_52_1293 413
276 iso_pr_bacteria 2820714932 2820716273 413
277 3300005083 Ga0068305_10052701 Ga0068305_100527015 414
278 3300024493 Ga0264413_101854 Ga0264413_1018542 414
279 3300042594 Ga0466694_150487 Ga0466694_150487_12211_13455 414
280 3300042594 Ga0466694_383070 Ga0466694_383070_376_1620 414
281 3300042607 Ga0466720_027770 Ga0466720_027770_21590_22834 414
282 3300042607 Ga0466720_045361 Ga0466720_045361_85875_87119 414
283 3300042609 Ga0466722_046563 Ga0466722_046563_5640_6884 414
284 3300042609 Ga0466722_095550 Ga0466722_095550_15942_17186 414
285 3300042609 Ga0466722_133214 Ga0466722_133214_13942_15186 414
286 3300042614 Ga0466712_018061 Ga0466712_018061_8431_9675 414
287 3300042616 Ga0466715_307818 Ga0466715_307818_9250_10494 414
288 3300042617 Ga0466718_061397 Ga0466718_061397_2383_3627 414
289 3300042617 Ga0466718_167671 Ga0466718_167671_13163_14407 414
290 3300042624 Ga0466735_142629 Ga0466735_142629_377_1621 414
291 iso_pr_bacteria 2820716747 2820717366 414
292 3300002449 JGI24698J34947_10003622 JGI24698J34947_100036227 415
293 3300005201 Ga0072941_1033709 Ga0072941_10337093 415
294 3300042593 Ga0466691_027648 Ga0466691_027648_590_1837 415
295 3300042614 Ga0466712_012580 Ga0466712_012580_10570_11817 415
296 3300042614 Ga0466712_087251 Ga0466712_087251_24796_26043 415
297 3300042617 Ga0466718_091226 Ga0466718_091226_13186_14433 415
298 3300042617 Ga0466718_133967 Ga0466718_133967_10481_11728 415
299 iso_pr_bacteria 2740892546 2743910035 415
300 iso_pr_bacteria 2773857779 2774479468 415
301 iso_pr_bacteria 2778260939 2778352250 415
302 iso_pr_bacteria 2820242869 2820243707 415
303 3300002449 JGI24698J34947_10004957 JGI24698J34947_100049571 416
304 3300002450 JGI24695J34938_10025770 JGI24695J34938_100257702 416
305 3300002509 JGI24699J35502_11098928 JGI24699J35502_110989283 416
306 3300002834 JGI24696J40584_12958665 JGI24696J40584_129586654 416
307 3300005201 Ga0072941_1012232 Ga0072941_101223225 416
308 3300005201 Ga0072941_1013063 Ga0072941_101306334 416
309 3300005201 Ga0072941_1024258 Ga0072941_102425825 416
310 3300005201 Ga0072941_1132255 Ga0072941_11322551 416
311 3300010167 Ga0123353_10105506 Ga0123353_101055063 416
312 3300000089 AustNasuHG_c1001679 AustNasuHG_10016791 417
313 3300000089 AustNasuHG_c1026128 AustNasuHG_10261282 417
314 3300005201 Ga0072941_1013067 Ga0072941_10130674 417
315 3300010049 Ga0123356_10305492 Ga0123356_103054922 417
316 3300012803 Ga0160465_102685 Ga0160465_1026852 417
317 3300024493 Ga0264413_105364 Ga0264413_1053645 417
318 3300042594 Ga0466694_095164 Ga0466694_095164_3941_5194 417
319 3300042599 Ga0466706_055045 Ga0466706_055045_15499_16752 417
320 3300042604 Ga0466717_170903 Ga0466717_170903_863_2116 417
321 iso_pr_bacteria 2740892545 2743908437 417
322 3300005201 Ga0072941_1000435 Ga0072941_100043518 418
323 3300009784 Ga0123357_10001076 Ga0123357_100010769 418
324 3300038395 Ga0415639_096143 Ga0415639_096143_3475_4731 418
325 3300042616 Ga0466715_420607 Ga0466715_420607_18324_19580 418
326 2225789004 2227558263 2228093232 419
327 3300042597 Ga0466699_023029 Ga0466699_023029_11340_12599 419
328 3300042599 Ga0466706_123989 Ga0466706_123989_1579_2838 419
329 3300042615 Ga0466711_296459 Ga0466711_296459_957_2216 419
330 3300002449 JGI24698J34947_10053700 JGI24698J34947_100537001 420
331 3300042603 Ga0466714_084828 Ga0466714_084828_1529_2791 420
332 3300042595 Ga0466695_370903 Ga0466695_370903_3159_4427 422
333 3300042598 Ga0466701_009668 Ga0466701_009668_2084_3355 423
334 3300042605 Ga0466716_309995 Ga0466716_309995_4500_5771 423
335 iso_pr_bacteria 2827179085 2827181084 423
336 iso_pr_bacteria 2971438493 2971441237 423
337 3300042606 Ga0466719_195650 Ga0466719_195650_3150_4427 425
338 3300042603 Ga0466714_138634 Ga0466714_138634_944_2224 426
339 3300042659 Ga0466733_163075 Ga0466733_163075_171_1451 426
340 iso_pr_bacteria 2820027804 2820029815 426
341 3300060766 Ga0590789_03731 Ga0590789_03731_31_1314 427
342 3300007052 Ga0102736_1000005 Ga0102736_100000541 428
343 3300005201 Ga0072941_1024312 Ga0072941_10243122 430
344 3300042618 Ga0466723_133803 Ga0466723_133803_457_1749 430
345 3300042619 Ga0466726_065034 Ga0466726_065034_1278_2570 430
346 3300010882 Ga0123354_10207393 Ga0123354_102073932 432
347 3300042654 Ga0466725_093035 Ga0466725_093035_8423_9721 432
348 3300042601 Ga0466707_158674 Ga0466707_158674_424_1725 433
349 3300012850 Ga0160434_102298 Ga0160434_1022982 435
350 3300042636 Ga0466703_281109 Ga0466703_281109_1663_2973 436
351 3300042655 Ga0466727_044140 Ga0466727_044140_27874_29205 436
352 iso_pr_bacteria 2820288918 2820289320 437
353 3300042612 Ga0466705_137351 Ga0466705_137351_1723_3039 438
354 iso_pr_bacteria 2820301196 2820301496 454
355 3300042655 Ga0466727_294815 Ga0466727_294815_111_1505 464
356 3300042619 Ga0466726_266592 Ga0466726_266592_922_2352 476

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00764 Arginosuc_synth Arginosuccinate synthase N-terminal HUP domain 63 228 0.98
PF20979 Arginosuc_syn_C Arginosuccinate synthase C-terminal domain 237 458 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.95 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.