Protein Family IF08267

Metagenome Isolate
125 Members
38 Samples
122 Scaffolds
648.74 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_225766|Ga0466726_225766_26509_28821
Length
760 aa
Sequence
MTEIKREDDFEKTPITAEVRDVDITNAMGGVLTEEQQKLIEDLDKESSVRKLSNPLLAQLFYFACIGVTMFHVWAAFKPPAVQKYRAIHVAMMLVLGFIMYPFSKKSNYKKVSVFDWIFVILSLMAPIYVWLEYEGIIMRAGNANRNDMIMATILVVLVLEASRRMSGWALPILSIIFIAYGLWGRYMPGIFGHRGYTWLQLSNKLFPDTEGIYGSSVSVAASFIYLFILFGAVMAKSGMGAFFNDIAMSLAGHTKGGPAKVSVISSGLLGSINGSAVANVVTTGAFTIPLMKRTGYSREFAGAVEAASSVGGQLLPPVMGAAAFIMAEILSVKYSVIIVHAAIPALLYYLGIIIQVHLRAGKLNLVGIAKDKLPKAGAVMRDKGHLLIPICVLLYYLLFSGKTVVYAVSMLRPSTSMSFKDILDACADGAKQTVSVAMXXXXVGIVVGVISKTGFGFTMANAIITLGAKSLLLTLLFTMVTCMILGMGVPSIPAYIITSAIAAPALAKLGIPVIAAHMFAFYFAMFANLTPPVALAAFAAAGLSGGNPMKTGWASVKLAIAGFLVPYMFIYSPQLLLIDTPLLEGIRVAIGACVGVLLIGSAVEGYLFTSMEWFVRIVSFAGALCLIDGGLVTDLIGAGVLIEVVALQYIVASGMPKKSWAVICVKSLFGGITGLFIGMPLSYQFQAPIIRDTVSLGKYIEEISRLLTHTPSPYEGTIAGSPAVLAITCLVCAAAGLVIMYAVARSRSPLSRRARPEDF

📊 Sample Types

Isolate 2.4%
Metagenome 97.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 37.8%
Termitidae 29.7%
Rhinotermitidae 8.1%
Termopsidae 8.1%
Unclassified 8.1%
Blattidae 5.4%
Passalidae 2.7%

🌳 Taxonomy

Archaea 2
Bacteria 120
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940241992 Fusobacterium sp. PH5-29 Isolate Blattidae
2 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
3 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
6 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
7 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
8 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
9 2940349480 Fusobacterium sp. PH5-44 Isolate Blattidae
10 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
11 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
12 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
13 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
14 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
15 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
16 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
17 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
18 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
19 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
22 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
23 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
24 2820068815 Unclassified Proteobacteria Nt197P3bin4 Isolate Unclassified
25 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
26 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
27 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
28 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
29 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
30 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
31 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
32 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
33 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
34 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
35 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
36 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
38 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466711_117435 3300042615 Bacteria 10619
2 Ga0466711_262289 3300042615 Bacteria 10318
3 Ga0466715_074513 3300042616 Bacteria 54317
4 Ga0466715_288595 3300042616 Bacteria 4782
5 Ga0466723_241261 3300042618 Bacteria 19593
6 Ga0466735_217525 3300042624 Bacteria 2369
7 Ga0466708_071140 3300042652 Bacteria 31733
8 Ga0466708_154414 3300042652 Bacteria 9419
9 Ga0466707_037546 3300042601 Bacteria 61203
10 Ga0264413_137037 3300024493 Bacteria 4880
11 Ga0466691_034611 3300042593 Bacteria 38039
12 Ga0466694_162313 3300042594 Unclassified 4066
13 Ga0466696_429262 3300042596 Bacteria 13084
14 Ga0466712_262690 3300042614 Bacteria 3991
15 Ga0466711_510954 3300042615 Bacteria 5822
16 Ga0466715_120110 3300042616 Bacteria 76368
17 Ga0466715_427900 3300042616 Bacteria 6259
18 Ga0466728_064550 3300042620 Bacteria 23023
19 Ga0466704_205883 3300042643 Bacteria 4619
20 Ga0466709_290311 3300042648 Bacteria 8369
21 Ga0466708_007363 3300042652 Bacteria 89244
22 Ga0466727_152874 3300042655 Bacteria 23015
23 Ga0466732_134381 3300042656 Bacteria 9062
24 Ga0466700_247259 3300042600 Bacteria 2867
25 Ga0466713_056349 3300042602 Bacteria 41260
26 Ga0466716_099513 3300042605 Bacteria 10345
27 Ga0466716_166312 3300042605 Bacteria 10260
28 Ga0466722_137234 3300042609 Bacteria 59873
29 Ga0466691_140009 3300042593 Bacteria 5362
30 Ga0466691_188178 3300042593 Bacteria 26502
31 Ga0466715_281023 3300042616 Bacteria 120480
32 Ga0466726_098228 3300042619 Bacteria 3006
33 Ga0466726_225766 3300042619 Bacteria 34437
34 Ga0466731_056112 3300042622 Bacteria 2996
35 Ga0466703_367154 3300042636 Bacteria 25683
36 Ga0466704_032652 3300042643 Bacteria 72699
37 Ga0466709_203164 3300042648 Bacteria 3302
38 Ga0466709_273987 3300042648 Bacteria 7436
39 Ga0466708_108728 3300042652 Bacteria 9167
40 JGI24698J34947_10014371 3300002449 Bacteria 4309
41 JGI24702J35022_10016790 3300002462 Bacteria 4009
42 Ga0466705_032243 3300042612 Bacteria 4453
43 Ga0466705_153619 3300042612 Bacteria 44502
44 Ga0466707_357293 3300042601 Bacteria 11679
45 Ga0466713_050812 3300042602 Bacteria 60158
46 Ga0466714_087719 3300042603 Bacteria 12001
47 Ga0466722_226905 3300042609 Bacteria 6398
48 Ga0466690_083867 3300042590 Bacteria 2241
49 Ga0466692_053324 3300042591 Bacteria 44513
50 Ga0466691_005367 3300042593 Bacteria 5769
51 Ga0466691_068585 3300042593 Bacteria 7874
52 Ga0466696_473086 3300042596 Bacteria 14574
53 Ga0466712_010960 3300042614 Bacteria 11349
54 Ga0466715_425563 3300042616 Bacteria 19779
55 Ga0466718_094709 3300042617 Bacteria 2572
56 Ga0466726_016911 3300042619 Bacteria 21357
57 Ga0466726_086979 3300042619 Bacteria 39268
58 Ga0466728_197039 3300042620 Bacteria 33942
59 Ga0466728_257758 3300042620 Bacteria 2941
60 Ga0466729_013017 3300042621 Bacteria 3650
61 Ga0466729_014996 3300042621 Bacteria 10193
62 Ga0466704_056915 3300042643 Bacteria 4746
63 Ga0466713_050093 3300042602 Bacteria 46522
64 Ga0466713_050928 3300042602 Bacteria 10963
65 Ga0466716_544988 3300042605 Bacteria 16037
66 Ga0466719_163033 3300042606 Bacteria 15228
67 Ga0466719_269396 3300042606 Bacteria 2410
68 Ga0264413_100434 3300024493 Bacteria 8623
69 Ga0264413_116111 3300024493 Bacteria 8195
70 Ga0466692_128725 3300042591 Bacteria 26676
71 Ga0466691_015227 3300042593 Bacteria 3506
72 Ga0466705_526576 3300042612 Bacteria 2290
73 Ga0466715_312159 3300042616 Bacteria 6174
74 Ga0466723_026563 3300042618 Bacteria 110971
75 Ga0466728_486886 3300042620 Bacteria 6299
76 Ga0123353_10183930 3300010167 Bacteria 3306
77 Ga0466704_435565 3300042643 Bacteria 5118
78 Ga0466708_102171 3300042652 Bacteria 5566
79 Ga0466708_180229 3300042652 Bacteria 7648
80 2227496839 2225789004 Bacteria 20032
81 Ga0466707_233186 3300042601 Archaea 2390
82 Ga0466716_113016 3300042605 Bacteria 20062
83 Ga0466722_108443 3300042609 Bacteria 33937
84 Ga0466711_012706 3300042615 Bacteria 9502
85 Ga0466711_241729 3300042615 Bacteria 7005
86 Ga0466715_000329 3300042616 Bacteria 32767
87 Ga0466728_147006 3300042620 Bacteria 11165
88 Ga0466728_318885 3300042620 Bacteria 5148
89 Ga0123356_10011832 3300010049 Bacteria 8493
90 Ga0123353_10161872 3300010167 Bacteria 3562
91 Ga0466708_174350 3300042652 Bacteria 23395
92 Ga0466708_399104 3300042652 Bacteria 9886
93 JGI24698J34947_10007910 3300002449 Bacteria 5840
94 Ga0466705_016179 3300042612 Bacteria 11454
95 Ga0466707_097433 3300042601 Bacteria 3641
96 Ga0466722_117480 3300042609 Bacteria 3860
97 Ga0466692_174121 3300042591 Bacteria 17424
98 Ga0466712_055981 3300042614 Unclassified 13068
99 Ga0466711_130523 3300042615 Bacteria 26282
100 Ga0466711_456895 3300042615 Bacteria 16604
101 Ga0466715_535681 3300042616 Bacteria 13314
102 Ga0466715_628292 3300042616 Bacteria 105793
103 Ga0466726_219720 3300042619 Bacteria 2894
104 Ga0466728_144629 3300042620 Bacteria 9192
105 Ga0466735_187748 3300042624 Bacteria 3620
106 Ga0466703_015090 3300042636 Bacteria 32409
107 Ga0466703_412453 3300042636 Archaea 4620
108 Ga0466704_258523 3300042643 Bacteria 28420
109 Ga0466704_577516 3300042643 Bacteria 2179
110 Ga0466727_087606 3300042655 Bacteria 9974
111 JGI24702J35022_10016877 3300002462 Unclassified 3997
112 Ga0466696_352179 3300042596 Bacteria 6873
113 Ga0466711_083521 3300042615 Bacteria 30635
114 Ga0466718_062339 3300042617 Bacteria 3636
115 Ga0466726_427912 3300042619 Bacteria 2496
116 Ga0123356_10050955 3300010049 Bacteria 3851
117 Ga0466735_018835 3300042624 Bacteria 5138
118 Ga0466735_033736 3300042624 Bacteria 3028
119 Ga0466708_283707 3300042652 Bacteria 6572
120 Ga0466727_347552 3300042655 Bacteria 17545
121 JGI24698J34947_10000389 3300002449 Bacteria 19820
122 JGI24698J34947_10001286 3300002449 Bacteria 13140

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042614 Ga0466712_055981 Ga0466712_055981_11261_13054 557
2 3300042624 Ga0466735_217525 Ga0466735_217525_13_1743 576
3 3300042652 Ga0466708_007363 Ga0466708_007363_85289_87307 593
4 3300042600 Ga0466700_247259 Ga0466700_247259_671_2716 602
5 3300042601 Ga0466707_037546 Ga0466707_037546_13874_15883 613
6 3300042602 Ga0466713_056349 Ga0466713_056349_30307_32259 615
7 3300042615 Ga0466711_262289 Ga0466711_262289_3315_5345 615
8 3300042615 Ga0466711_510954 Ga0466711_510954_397_2421 616
9 3300042615 Ga0466711_130523 Ga0466711_130523_4508_6517 617
10 3300042612 Ga0466705_016179 Ga0466705_016179_6498_8486 618
11 3300042656 Ga0466732_134381 Ga0466732_134381_2024_4021 619
12 3300042621 Ga0466729_014996 Ga0466729_014996_1475_3496 621
13 3300042603 Ga0466714_087719 Ga0466714_087719_6368_8389 622
14 3300042615 Ga0466711_083521 Ga0466711_083521_24915_26852 626
15 3300042615 Ga0466711_117435 Ga0466711_117435_495_2507 628
16 3300042655 Ga0466727_087606 Ga0466727_087606_4256_6307 628
17 3300002449 JGI24698J34947_10000389 JGI24698J34947_100003895 629
18 3300002449 JGI24698J34947_10014371 JGI24698J34947_100143713 629
19 3300042616 Ga0466715_000329 Ga0466715_000329_1962_3989 629
20 3300024493 Ga0264413_100434 Ga0264413_10043410 630
21 3300042601 Ga0466707_097433 Ga0466707_097433_1600_3594 633
22 3300042648 Ga0466709_273987 Ga0466709_273987_4586_6613 633
23 3300042591 Ga0466692_174121 Ga0466692_174121_11188_13155 634
24 3300042609 Ga0466722_226905 Ga0466722_226905_4327_6312 634
25 3300002449 JGI24698J34947_10001286 JGI24698J34947_100012864 635
26 3300002449 JGI24698J34947_10007910 JGI24698J34947_100079104 635
27 3300042605 Ga0466716_099513 Ga0466716_099513_391_2388 635
28 3300042614 Ga0466712_262690 Ga0466712_262690_1759_3765 635
29 3300042616 Ga0466715_074513 Ga0466715_074513_45415_47412 635
30 3300042612 Ga0466705_032243 Ga0466705_032243_1724_3709 636
31 3300042614 Ga0466712_010960 Ga0466712_010960_976_2991 636
32 3300042620 Ga0466728_197039 Ga0466728_197039_6868_8868 636
33 3300042612 Ga0466705_526576 Ga0466705_526576_153_2207 637
34 3300042619 Ga0466726_427912 Ga0466726_427912_134_2152 637
35 3300042593 Ga0466691_005367 Ga0466691_005367_296_2302 638
36 3300042606 Ga0466719_163033 Ga0466719_163033_9821_11827 638
37 3300042591 Ga0466692_128725 Ga0466692_128725_23266_25242 639
38 3300042616 Ga0466715_628292 Ga0466715_628292_7166_9154 639
39 3300042652 Ga0466708_102171 Ga0466708_102171_1625_3661 639
40 3300042617 Ga0466718_094709 Ga0466718_094709_148_2142 640
41 3300042591 Ga0466692_053324 Ga0466692_053324_29324_31369 641
42 3300042602 Ga0466713_050093 Ga0466713_050093_3096_5153 641
43 3300042609 Ga0466722_137234 Ga0466722_137234_941_2986 641
44 3300042643 Ga0466704_056915 Ga0466704_056915_1936_3942 641
45 3300042618 Ga0466723_241261 Ga0466723_241261_8043_10067 642
46 3300042620 Ga0466728_257758 Ga0466728_257758_130_2175 642
47 3300042620 Ga0466728_318885 Ga0466728_318885_495_2495 642
48 3300042643 Ga0466704_032652 Ga0466704_032652_51118_53187 642
49 3300042652 Ga0466708_174350 Ga0466708_174350_17715_19727 643
50 3300010167 Ga0123353_10183930 Ga0123353_101839302 644
51 3300042590 Ga0466690_083867 Ga0466690_083867_25_2049 644
52 3300042596 Ga0466696_429262 Ga0466696_429262_329_2350 644
53 3300042605 Ga0466716_113016 Ga0466716_113016_5241_7295 644
54 3300042620 Ga0466728_144629 Ga0466728_144629_5909_7843 644
55 3300042652 Ga0466708_180229 Ga0466708_180229_2421_4475 644
56 3300010049 Ga0123356_10011832 Ga0123356_100118326 645
57 3300042593 Ga0466691_140009 Ga0466691_140009_1884_3860 645
58 3300042605 Ga0466716_166312 Ga0466716_166312_634_2649 645
59 3300042616 Ga0466715_312159 Ga0466715_312159_1895_4012 645
60 3300042616 Ga0466715_425563 Ga0466715_425563_16302_18332 645
61 3300042648 Ga0466709_290311 Ga0466709_290311_772_2781 645
62 3300042593 Ga0466691_015227 Ga0466691_015227_446_2458 646
63 3300042615 Ga0466711_012706 Ga0466711_012706_480_2510 646
64 3300042655 Ga0466727_152874 Ga0466727_152874_18893_20866 646
65 3300024493 Ga0264413_116111 Ga0264413_1161118 647
66 3300042619 Ga0466726_098228 Ga0466726_098228_845_2881 648
67 3300042619 Ga0466726_219720 Ga0466726_219720_144_2210 649
68 3300010049 Ga0123356_10050955 Ga0123356_100509552 650
69 3300024493 Ga0264413_137037 Ga0264413_1370372 650
70 3300042619 Ga0466726_086979 Ga0466726_086979_35243_37330 650
71 3300042624 Ga0466735_018835 Ga0466735_018835_891_2936 650
72 3300042652 Ga0466708_154414 Ga0466708_154414_4783_6813 650
73 3300042616 Ga0466715_427900 Ga0466715_427900_331_2343 651
74 3300042620 Ga0466728_486886 Ga0466728_486886_1517_3556 651
75 3300042616 Ga0466715_288595 Ga0466715_288595_2208_4214 653
76 3300042622 Ga0466731_056112 Ga0466731_056112_434_2455 653
77 3300042619 Ga0466726_016911 Ga0466726_016911_15590_17587 654
78 3300042643 Ga0466704_258523 Ga0466704_258523_17989_20109 654
79 3300042624 Ga0466735_187748 Ga0466735_187748_115_2172 655
80 3300042636 Ga0466703_015090 Ga0466703_015090_16144_18210 656
81 3300042615 Ga0466711_456895 Ga0466711_456895_7349_9373 657
82 3300042593 Ga0466691_034611 Ga0466691_034611_11752_13794 659
83 3300042593 Ga0466691_068585 Ga0466691_068585_2076_4163 659
84 3300042621 Ga0466729_013017 Ga0466729_013017_1581_3608 659
85 3300042655 Ga0466727_347552 Ga0466727_347552_234_2282 659
86 3300042602 Ga0466713_050928 Ga0466713_050928_983_2965 660
87 3300042617 Ga0466718_062339 Ga0466718_062339_757_2781 660
88 3300042618 Ga0466723_026563 Ga0466723_026563_90035_92071 660
89 3300042624 Ga0466735_033736 Ga0466735_033736_177_2204 660
90 iso_pr_bacteria 2940241992 2940244358 660
91 iso_pr_bacteria 2940349480 2940351867 660
92 3300042605 Ga0466716_544988 Ga0466716_544988_10092_12131 661
93 3300042616 Ga0466715_535681 Ga0466715_535681_1743_3752 661
94 3300042648 Ga0466709_203164 Ga0466709_203164_563_2587 661
95 3300042616 Ga0466715_120110 Ga0466715_120110_44468_46513 662
96 3300010167 Ga0123353_10161872 Ga0123353_101618723 663
97 3300042643 Ga0466704_577516 Ga0466704_577516_59_2104 663
98 3300042596 Ga0466696_352179 Ga0466696_352179_4578_6689 664
99 3300042602 Ga0466713_050812 Ga0466713_050812_43754_45820 664
100 3300042620 Ga0466728_147006 Ga0466728_147006_8823_10937 664
101 3300042652 Ga0466708_071140 Ga0466708_071140_7453_9504 664
102 3300002462 JGI24702J35022_10016790 JGI24702J35022_100167903 665
103 3300002462 JGI24702J35022_10016877 JGI24702J35022_100168771 665
104 3300042643 Ga0466704_435565 Ga0466704_435565_468_2495 666
105 3300042615 Ga0466711_241729 Ga0466711_241729_283_2385 668
106 3300042643 Ga0466704_205883 Ga0466704_205883_518_2557 668
107 3300042636 Ga0466703_367154 Ga0466703_367154_4701_6731 670
108 3300042620 Ga0466728_064550 Ga0466728_064550_17969_20020 671
109 3300042652 Ga0466708_399104 Ga0466708_399104_2574_4592 672
110 3300042596 Ga0466696_473086 Ga0466696_473086_8019_10055 673
111 3300042609 Ga0466722_117480 Ga0466722_117480_65_2107 674
112 3300042616 Ga0466715_281023 Ga0466715_281023_91644_93668 674
113 3300042601 Ga0466707_357293 Ga0466707_357293_5364_7394 676
114 3300042652 Ga0466708_108728 Ga0466708_108728_5485_7611 676
115 3300042636 Ga0466703_412453 Ga0466703_412453_595_2628 677
116 3300042652 Ga0466708_283707 Ga0466708_283707_2254_4290 678
117 3300042593 Ga0466691_188178 Ga0466691_188178_3716_5755 679
118 3300042606 Ga0466719_269396 Ga0466719_269396_260_2299 679
119 iso_pr_bacteria 2820068815 2820069567 679
120 3300042612 Ga0466705_153619 Ga0466705_153619_19044_21104 680
121 3300042594 Ga0466694_162313 Ga0466694_162313_1864_3918 684
122 2225789004 2227496839 2227974868 687
123 3300042601 Ga0466707_233186 Ga0466707_233186_266_2329 687
124 3300042609 Ga0466722_108443 Ga0466722_108443_18730_21021 730
125 3300042619 Ga0466726_225766 Ga0466726_225766_26509_28821 760

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF06808 DctM Tripartite ATP-independent periplasmic transporter, DctM component 155 580 0.91

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.