Protein Family IF08266
Metagenome
Isolate
160
Members
83
Samples
113
Scaffolds
429.94
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_224822|Ga0466726_224822_83_1612
- Length
- 509 aa
- Sequence
- MTEPLHSDSNTVIVDVRTTEEFFGGHIDKSVNIPLEKIVSSVENLKKYDNIIIVCASGKRSAQAKSILEGEGLKNVHDGGGCQNFYETQQIIALIKREVVPAIGCTEPVAVAFAVAKAKEILGCLPEKIDVSLSANVLKNAMGVGIPGTGMIGLPIAIALGAITGKSEYGLEVLKDITNNALEQGKKMIEEKKINISLCENAPNQLYIATTVKNGSESVKVVVCEEHTKIVRIEKNGKTIFEEKISPAEENNTEITQTLSMRKVYDFAMETPTDDIKFILEAAKINSAAAEKALNMSYGHSLGRTMTGIYEHQIMGDSMLSKILAYTSSACDARMGGAMIPVMTNSGSGNQGITATLPVAVFAREMKKSEEQLIRALILSSLTVIYIKQSMGRLSALCGCVVASTGSACGITYLMGGGYEQICYAVKNMVANLAGMVCDGAKPSCSLKVSSSAATAVFSAMMAMEGKFVKSVEGIIDNDVDKSIHNLTRIASSGMCETDKMILEIMTGK
Sample Types
Isolate
29.4%
Metagenome
70.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
50.0%
Kalotermitidae
17.1%
Termitidae
13.4%
Unclassified
8.5%
Rhinotermitidae
3.7%
Termopsidae
3.7%
Passalidae
2.4%
Hodotermitidae
1.2%
Taxonomy
Archaea
0
Bacteria
157
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 2 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 3 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 4 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 5 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 6 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 7 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 8 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 11 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 12 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 13 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 14 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 15 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 18 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 19 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 20 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 21 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 24 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 25 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 26 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 27 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 28 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 29 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 30 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 31 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 32 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 33 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 34 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 35 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 36 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 37 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 38 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 39 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 40 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 41 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 42 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 43 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 44 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 45 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 46 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 47 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 48 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 49 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 50 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 51 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 52 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 53 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 54 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 55 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 56 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 57 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 58 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 59 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 60 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 61 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 62 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 63 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 64 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 65 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 66 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 67 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 68 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 69 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 70 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 71 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 72 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 73 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 74 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 75 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 76 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 77 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 78 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 79 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 80 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 81 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 82 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 83 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_185873 | 3300042612 | Bacteria | 9001 |
| 2 | Ga0466733_141558 | 3300042659 | Bacteria | 10167 |
| 3 | IMNBL1DRAFT_c0001443 | 3300000062 | Bacteria | 17766 |
| 4 | Ga0466691_095246 | 3300042593 | Bacteria | 18091 |
| 5 | Ga0466691_099055 | 3300042593 | Bacteria | 3675 |
| 6 | Ga0466703_367008 | 3300042636 | Bacteria | 30950 |
| 7 | Ga0466706_134925 | 3300042599 | Bacteria | 10927 |
| 8 | Ga0466707_213366 | 3300042601 | Bacteria | 3914 |
| 9 | Ga0466713_041499 | 3300042602 | Bacteria | 101217 |
| 10 | Ga0466714_008609 | 3300042603 | Bacteria | 4341 |
| 11 | Ga0466717_083168 | 3300042604 | Bacteria | 1553 |
| 12 | Ga0466733_055750 | 3300042659 | Bacteria | 12185 |
| 13 | Ga0466705_494792 | 3300042612 | Bacteria | 3038 |
| 14 | Ga0466711_451493 | 3300042615 | Bacteria | 10844 |
| 15 | Ga0466715_170026 | 3300042616 | Bacteria | 29950 |
| 16 | Ga0466731_088179 | 3300042622 | Bacteria | 4690 |
| 17 | Ga0466735_002261 | 3300042624 | Bacteria | 2668 |
| 18 | Ga0466704_189809 | 3300042643 | Bacteria | 10799 |
| 19 | Ga0466709_081332 | 3300042648 | Unclassified | 50852 |
| 20 | Ga0466709_298775 | 3300042648 | Bacteria | 18829 |
| 21 | Ga0466709_328692 | 3300042648 | Bacteria | 228895 |
| 22 | Ga0466708_225726 | 3300042652 | Bacteria | 5929 |
| 23 | Ga0466706_028005 | 3300042599 | Bacteria | 12952 |
| 24 | Ga0466706_034191 | 3300042599 | Bacteria | 44289 |
| 25 | Ga0466706_163481 | 3300042599 | Bacteria | 45216 |
| 26 | Ga0466707_296253 | 3300042601 | Bacteria | 25031 |
| 27 | Ga0466713_009775 | 3300042602 | Bacteria | 66246 |
| 28 | Ga0466713_020351 | 3300042602 | Bacteria | 91390 |
| 29 | Ga0466733_061316 | 3300042659 | Bacteria | 145079 |
| 30 | Ga0466710_032215 | 3300042613 | Bacteria | 1496 |
| 31 | Ga0466711_114294 | 3300042615 | Bacteria | 16823 |
| 32 | Ga0466711_350231 | 3300042615 | Bacteria | 5994 |
| 33 | Ga0466726_224822 | 3300042619 | Bacteria | 3003 |
| 34 | Ga0466691_023019 | 3300042593 | Bacteria | 12671 |
| 35 | Ga0466691_050053 | 3300042593 | Bacteria | 6806 |
| 36 | Ga0466691_163996 | 3300042593 | Bacteria | 6431 |
| 37 | Ga0466696_049113 | 3300042596 | Bacteria | 63300 |
| 38 | Ga0466696_190653 | 3300042596 | Bacteria | 1472 |
| 39 | Ga0466714_099856 | 3300042603 | Bacteria | 26552 |
| 40 | Ga0466719_124633 | 3300042606 | Bacteria | 9034 |
| 41 | Ga0466705_124204 | 3300042612 | Bacteria | 47476 |
| 42 | Ga0466705_212723 | 3300042612 | Bacteria | 3592 |
| 43 | IMNBL1DRAFT_c0000059 | 3300000062 | Bacteria | 103534 |
| 44 | IMNBL1DRAFT_c0013142 | 3300000062 | Bacteria | 3736 |
| 45 | JGI24702J35022_10105898 | 3300002462 | Bacteria | 1543 |
| 46 | Ga0466715_045980 | 3300042616 | Bacteria | 33517 |
| 47 | Ga0160452_100659 | 3300012834 | Bacteria | 17948 |
| 48 | Ga0466696_070746 | 3300042596 | Bacteria | 74081 |
| 49 | Ga0466696_136965 | 3300042596 | Bacteria | 5525 |
| 50 | Ga0466696_251801 | 3300042596 | Bacteria | 32029 |
| 51 | Ga0466735_217815 | 3300042624 | Bacteria | 1768 |
| 52 | Ga0466724_50759 | 3300042649 | Bacteria | 4502 |
| 53 | Ga0466727_215099 | 3300042655 | Bacteria | 1655 |
| 54 | Ga0466713_051288 | 3300042602 | Bacteria | 230715 |
| 55 | Ga0466713_143155 | 3300042602 | Bacteria | 188721 |
| 56 | Ga0466714_075303 | 3300042603 | Bacteria | 17951 |
| 57 | Ga0466716_056469 | 3300042605 | Bacteria | 5667 |
| 58 | Ga0466697_176725 | 3300042611 | Bacteria | 2995 |
| 59 | Ga0466733_094314 | 3300042659 | Unclassified | 1707 |
| 60 | Ga0466715_440066 | 3300042616 | Bacteria | 13179 |
| 61 | Ga0466723_064929 | 3300042618 | Bacteria | 41064 |
| 62 | Ga0466728_044515 | 3300042620 | Bacteria | 5778 |
| 63 | Ga0466728_192677 | 3300042620 | Bacteria | 2484 |
| 64 | Ga0466729_038665 | 3300042621 | Bacteria | 15259 |
| 65 | Ga0466690_225246 | 3300042590 | Bacteria | 6354 |
| 66 | Ga0466691_163200 | 3300042593 | Bacteria | 4992 |
| 67 | Ga0466696_496124 | 3300042596 | Bacteria | 2353 |
| 68 | Ga0466703_242939 | 3300042636 | Bacteria | 13750 |
| 69 | Ga0466704_235767 | 3300042643 | Bacteria | 4757 |
| 70 | Ga0466708_027130 | 3300042652 | Bacteria | 4645 |
| 71 | Ga0466708_139052 | 3300042652 | Bacteria | 5245 |
| 72 | Ga0466706_138933 | 3300042599 | Bacteria | 6203 |
| 73 | Ga0466707_044234 | 3300042601 | Bacteria | 8494 |
| 74 | Ga0466713_033702 | 3300042602 | Bacteria | 18682 |
| 75 | Ga0466713_052484 | 3300042602 | Bacteria | 51192 |
| 76 | Ga0466714_159678 | 3300042603 | Bacteria | 13291 |
| 77 | Ga0466716_011142 | 3300042605 | Bacteria | 3530 |
| 78 | IMNBL1DRAFT_c0000937 | 3300000062 | Bacteria | 22532 |
| 79 | Ga0466723_141568 | 3300042618 | Bacteria | 16577 |
| 80 | Ga0466657_273247 | 3300042582 | Bacteria | 4220 |
| 81 | Ga0466735_078756 | 3300042624 | Bacteria | 2833 |
| 82 | Ga0466735_127512 | 3300042624 | Bacteria | 15862 |
| 83 | Ga0466706_171746 | 3300042599 | Bacteria | 69301 |
| 84 | Ga0466707_012189 | 3300042601 | Bacteria | 5935 |
| 85 | Ga0068305_10172136 | 3300005083 | Unclassified | 4668 |
| 86 | Ga0466711_092017 | 3300042615 | Bacteria | 9384 |
| 87 | Ga0466711_494046 | 3300042615 | Bacteria | 3696 |
| 88 | Ga0466715_066044 | 3300042616 | Bacteria | 3702 |
| 89 | Ga0466723_023030 | 3300042618 | Bacteria | 16011 |
| 90 | Ga0466690_180282 | 3300042590 | Bacteria | 25954 |
| 91 | Ga0466694_321800 | 3300042594 | Bacteria | 29415 |
| 92 | Ga0466695_212656 | 3300042595 | Bacteria | 4744 |
| 93 | Ga0466703_225503 | 3300042636 | Bacteria | 9103 |
| 94 | Ga0466704_216571 | 3300042643 | Bacteria | 9337 |
| 95 | Ga0466704_446923 | 3300042643 | Bacteria | 3231 |
| 96 | Ga0466704_502176 | 3300042643 | Bacteria | 1835 |
| 97 | Ga0466706_037437 | 3300042599 | Bacteria | 17939 |
| 98 | Ga0466706_121012 | 3300042599 | Bacteria | 39559 |
| 99 | 2227155811 | 2225789004 | Bacteria | 8444 |
| 100 | IMNBL1DRAFT_c0005049 | 3300000062 | Bacteria | 7687 |
| 101 | Ga0466710_107103 | 3300042613 | Bacteria | 16718 |
| 102 | Ga0466711_023837 | 3300042615 | Bacteria | 62988 |
| 103 | Ga0466715_111811 | 3300042616 | Bacteria | 33974 |
| 104 | Ga0466715_165372 | 3300042616 | Bacteria | 16231 |
| 105 | Ga0466690_354941 | 3300042590 | Bacteria | 44034 |
| 106 | Ga0466696_113588 | 3300042596 | Bacteria | 6004 |
| 107 | Ga0466729_264172 | 3300042621 | Bacteria | 5257 |
| 108 | Ga0466735_222090 | 3300042624 | Bacteria | 5320 |
| 109 | Ga0466709_017802 | 3300042648 | Bacteria | 72752 |
| 110 | Ga0466706_027208 | 3300042599 | Bacteria | 10452 |
| 111 | Ga0466707_112391 | 3300042601 | Bacteria | 11861 |
| 112 | Ga0466713_093396 | 3300042602 | Bacteria | 9732 |
| 113 | Ga0466713_093846 | 3300042602 | Bacteria | 70842 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042622 | Ga0466731_088179 | Ga0466731_088179_1878_3155 | 401 |
| 2 | 3300042593 | Ga0466691_163996 | Ga0466691_163996_159_1454 | 408 |
| 3 | 3300042618 | Ga0466723_023030 | Ga0466723_023030_427_1707 | 409 |
| 4 | 3300042601 | Ga0466707_012189 | Ga0466707_012189_4598_5884 | 410 |
| 5 | 3300042601 | Ga0466707_296253 | Ga0466707_296253_920_2200 | 410 |
| 6 | 3300042649 | Ga0466724_50759 | Ga0466724_50759_2778_4061 | 410 |
| 7 | 3300042613 | Ga0466710_032215 | Ga0466710_032215_232_1473 | 413 |
| 8 | 3300042621 | Ga0466729_264172 | Ga0466729_264172_1955_3238 | 413 |
| 9 | 3300042596 | Ga0466696_136965 | Ga0466696_136965_2628_3875 | 415 |
| 10 | 3300042599 | Ga0466706_027208 | Ga0466706_027208_5836_7122 | 415 |
| 11 | 3300002462 | JGI24702J35022_10105898 | JGI24702J35022_101058982 | 417 |
| 12 | 3300042602 | Ga0466713_143155 | Ga0466713_143155_167158_168441 | 417 |
| 13 | 3300042648 | Ga0466709_081332 | Ga0466709_081332_8524_9807 | 417 |
| 14 | 3300042602 | Ga0466713_041499 | Ga0466713_041499_71070_72356 | 419 |
| 15 | 3300042615 | Ga0466711_494046 | Ga0466711_494046_2373_3656 | 421 |
| 16 | 3300042593 | Ga0466691_163200 | Ga0466691_163200_3212_4483 | 423 |
| 17 | 3300042602 | Ga0466713_093396 | Ga0466713_093396_371_1642 | 423 |
| 18 | 3300042624 | Ga0466735_217815 | Ga0466735_217815_273_1544 | 423 |
| 19 | iso_pr_bacteria | 3004667792 | 3004667947 | 423 |
| 20 | 3300042606 | Ga0466719_124633 | Ga0466719_124633_7359_8633 | 424 |
| 21 | 3300042615 | Ga0466711_023837 | Ga0466711_023837_42639_43913 | 424 |
| 22 | 3300042616 | Ga0466715_066044 | Ga0466715_066044_301_1575 | 424 |
| 23 | 3300042601 | Ga0466707_112391 | Ga0466707_112391_7621_8898 | 425 |
| 24 | 3300042593 | Ga0466691_099055 | Ga0466691_099055_1686_2966 | 426 |
| 25 | 3300042596 | Ga0466696_049113 | Ga0466696_049113_45200_46480 | 426 |
| 26 | 3300042596 | Ga0466696_113588 | Ga0466696_113588_2910_4190 | 426 |
| 27 | 3300042602 | Ga0466713_052484 | Ga0466713_052484_3915_5195 | 426 |
| 28 | 3300042603 | Ga0466714_099856 | Ga0466714_099856_20400_21719 | 426 |
| 29 | 3300042605 | Ga0466716_056469 | Ga0466716_056469_2896_4176 | 426 |
| 30 | 3300042621 | Ga0466729_038665 | Ga0466729_038665_7286_8566 | 426 |
| 31 | 3300042624 | Ga0466735_127512 | Ga0466735_127512_8112_9392 | 426 |
| 32 | 3300042652 | Ga0466708_027130 | Ga0466708_027130_571_1851 | 426 |
| 33 | iso_pr_bacteria | 2940380068 | 2940382077 | 426 |
| 34 | iso_pr_bacteria | 2940386776 | 2940389050 | 426 |
| 35 | iso_pr_bacteria | 2940393498 | 2940395501 | 426 |
| 36 | iso_pr_bacteria | 2940400224 | 2940402501 | 426 |
| 37 | iso_pr_bacteria | 2940406939 | 2940406976 | 426 |
| 38 | iso_pr_bacteria | 3004672520 | 3004672731 | 426 |
| 39 | iso_pr_bacteria | 3004677695 | 3004678444 | 426 |
| 40 | 3300042593 | Ga0466691_095246 | Ga0466691_095246_7528_8811 | 427 |
| 41 | 3300042599 | Ga0466706_028005 | Ga0466706_028005_4727_6010 | 427 |
| 42 | 3300042602 | Ga0466713_020351 | Ga0466713_020351_61821_63104 | 427 |
| 43 | 3300042604 | Ga0466717_083168 | Ga0466717_083168_237_1520 | 427 |
| 44 | 3300042612 | Ga0466705_185873 | Ga0466705_185873_4089_5372 | 427 |
| 45 | 3300042613 | Ga0466710_107103 | Ga0466710_107103_11728_13011 | 427 |
| 46 | 3300042616 | Ga0466715_440066 | Ga0466715_440066_6588_7871 | 427 |
| 47 | 3300042636 | Ga0466703_225503 | Ga0466703_225503_1655_2938 | 427 |
| 48 | 3300042652 | Ga0466708_139052 | Ga0466708_139052_1787_3070 | 427 |
| 49 | 3300042659 | Ga0466733_061316 | Ga0466733_061316_14879_16162 | 427 |
| 50 | 3300042659 | Ga0466733_094314 | Ga0466733_094314_141_1424 | 427 |
| 51 | iso_pr_bacteria | 2695420314 | 2695470870 | 427 |
| 52 | iso_pr_bacteria | 2910942425 | 2910945557 | 427 |
| 53 | iso_pr_bacteria | 2922326829 | 2922327550 | 427 |
| 54 | iso_pr_bacteria | 2940244548 | 2940246145 | 427 |
| 55 | iso_pr_bacteria | 2940248789 | 2940249969 | 427 |
| 56 | iso_pr_bacteria | 2940253009 | 2940254043 | 427 |
| 57 | iso_pr_bacteria | 2940257232 | 2940258211 | 427 |
| 58 | iso_pr_bacteria | 8100166142 | 8100168532 | 427 |
| 59 | 3300000062 | IMNBL1DRAFT_c0001443 | IMNBL1DRAFT_00014437 | 428 |
| 60 | 3300000062 | IMNBL1DRAFT_c0013142 | IMNBL1DRAFT_00131422 | 428 |
| 61 | 3300042582 | Ga0466657_273247 | Ga0466657_273247_1421_2707 | 428 |
| 62 | 3300042594 | Ga0466694_321800 | Ga0466694_321800_25656_26942 | 428 |
| 63 | 3300042595 | Ga0466695_212656 | Ga0466695_212656_1273_2559 | 428 |
| 64 | 3300042596 | Ga0466696_251801 | Ga0466696_251801_27443_28729 | 428 |
| 65 | 3300042599 | Ga0466706_037437 | Ga0466706_037437_15285_16571 | 428 |
| 66 | 3300042599 | Ga0466706_163481 | Ga0466706_163481_31280_32566 | 428 |
| 67 | 3300042612 | Ga0466705_212723 | Ga0466705_212723_1273_2559 | 428 |
| 68 | 3300042615 | Ga0466711_114294 | Ga0466711_114294_1957_3243 | 428 |
| 69 | 3300042616 | Ga0466715_045980 | Ga0466715_045980_253_1539 | 428 |
| 70 | 3300042616 | Ga0466715_111811 | Ga0466715_111811_23868_25154 | 428 |
| 71 | 3300042652 | Ga0466708_225726 | Ga0466708_225726_2197_3483 | 428 |
| 72 | 3300042655 | Ga0466727_215099 | Ga0466727_215099_189_1475 | 428 |
| 73 | 3300042659 | Ga0466733_055750 | Ga0466733_055750_1044_2330 | 428 |
| 74 | iso_pr_bacteria | 2820792843 | 2820793350 | 428 |
| 75 | iso_pr_bacteria | 2820795054 | 2820797525 | 428 |
| 76 | iso_pr_bacteria | 2910926975 | 2910926984 | 428 |
| 77 | iso_pr_bacteria | 2910959314 | 2910960645 | 428 |
| 78 | iso_pr_bacteria | 2923982719 | 2923984761 | 428 |
| 79 | iso_pr_bacteria | 2940371297 | 2940372448 | 428 |
| 80 | 3300000062 | IMNBL1DRAFT_c0000937 | IMNBL1DRAFT_00009375 | 429 |
| 81 | 3300042599 | Ga0466706_121012 | Ga0466706_121012_22212_23501 | 429 |
| 82 | 3300042602 | Ga0466713_051288 | Ga0466713_051288_130202_131491 | 429 |
| 83 | 3300042615 | Ga0466711_350231 | Ga0466711_350231_2196_3485 | 429 |
| 84 | 3300042624 | Ga0466735_078756 | Ga0466735_078756_800_2089 | 429 |
| 85 | 3300042648 | Ga0466709_017802 | Ga0466709_017802_53814_55103 | 429 |
| 86 | iso_pr_bacteria | 2940193328 | 2940193426 | 429 |
| 87 | iso_pr_bacteria | 2940195863 | 2940198908 | 429 |
| 88 | iso_pr_bacteria | 2940199050 | 2940201651 | 429 |
| 89 | iso_pr_bacteria | 2940205530 | 2940206449 | 429 |
| 90 | iso_pr_bacteria | 2940209341 | 2940209944 | 429 |
| 91 | iso_pr_bacteria | 2940212447 | 2940213276 | 429 |
| 92 | iso_pr_bacteria | 2940221333 | 2940222476 | 429 |
| 93 | iso_pr_bacteria | 2940298504 | 2940299420 | 429 |
| 94 | iso_pr_bacteria | 2940302308 | 2940303137 | 429 |
| 95 | iso_pr_bacteria | 2940306115 | 2940306949 | 429 |
| 96 | iso_pr_bacteria | 2940309933 | 2940310766 | 429 |
| 97 | iso_pr_bacteria | 2940313741 | 2940314519 | 429 |
| 98 | iso_pr_bacteria | 2940317558 | 2940318333 | 429 |
| 99 | iso_pr_bacteria | 2940321370 | 2940322146 | 429 |
| 100 | iso_pr_bacteria | 2940325180 | 2940326009 | 429 |
| 101 | iso_pr_bacteria | 2940328985 | 2940329903 | 429 |
| 102 | iso_pr_bacteria | 2940332795 | 2940333629 | 429 |
| 103 | iso_pr_bacteria | 2940336608 | 2940336705 | 429 |
| 104 | iso_pr_bacteria | 2940346213 | 2940348557 | 429 |
| 105 | iso_pr_bacteria | 2940413413 | 2940416071 | 429 |
| 106 | iso_pr_bacteria | 2940419646 | 2940422631 | 429 |
| 107 | iso_pr_bacteria | 2940425923 | 2940428438 | 429 |
| 108 | 3300012834 | Ga0160452_100659 | Ga0160452_10065914 | 430 |
| 109 | 3300042596 | Ga0466696_070746 | Ga0466696_070746_42648_43940 | 430 |
| 110 | 3300042599 | Ga0466706_138933 | Ga0466706_138933_4888_6180 | 430 |
| 111 | 3300042599 | Ga0466706_171746 | Ga0466706_171746_63046_64338 | 430 |
| 112 | 3300042605 | Ga0466716_011142 | Ga0466716_011142_847_2139 | 430 |
| 113 | 3300042612 | Ga0466705_494792 | Ga0466705_494792_187_1479 | 430 |
| 114 | 3300042620 | Ga0466728_192677 | Ga0466728_192677_838_2130 | 430 |
| 115 | 3300042624 | Ga0466735_002261 | Ga0466735_002261_994_2286 | 430 |
| 116 | 3300042636 | Ga0466703_367008 | Ga0466703_367008_10628_11920 | 430 |
| 117 | iso_pr_bacteria | 2609459943 | 2610743187 | 430 |
| 118 | iso_pr_bacteria | 2830041218 | 2830041384 | 430 |
| 119 | 3300000062 | IMNBL1DRAFT_c0005049 | IMNBL1DRAFT_00050494 | 431 |
| 120 | 3300042590 | Ga0466690_180282 | Ga0466690_180282_19073_20368 | 431 |
| 121 | 3300042596 | Ga0466696_190653 | Ga0466696_190653_162_1457 | 431 |
| 122 | 3300042599 | Ga0466706_034191 | Ga0466706_034191_10349_11644 | 431 |
| 123 | 3300042602 | Ga0466713_009775 | Ga0466713_009775_35576_36871 | 431 |
| 124 | 3300042612 | Ga0466705_124204 | Ga0466705_124204_37696_38991 | 431 |
| 125 | 3300042615 | Ga0466711_092017 | Ga0466711_092017_945_2240 | 431 |
| 126 | 3300042616 | Ga0466715_170026 | Ga0466715_170026_17517_18812 | 431 |
| 127 | 3300042620 | Ga0466728_044515 | Ga0466728_044515_1551_2846 | 431 |
| 128 | 3300042636 | Ga0466703_242939 | Ga0466703_242939_3723_5018 | 431 |
| 129 | 3300042643 | Ga0466704_189809 | Ga0466704_189809_5210_6505 | 431 |
| 130 | 3300042643 | Ga0466704_235767 | Ga0466704_235767_1347_2642 | 431 |
| 131 | 3300042643 | Ga0466704_446923 | Ga0466704_446923_136_1431 | 431 |
| 132 | 3300042590 | Ga0466690_225246 | Ga0466690_225246_4400_5698 | 432 |
| 133 | 3300042616 | Ga0466715_165372 | Ga0466715_165372_7389_8687 | 432 |
| 134 | 3300042648 | Ga0466709_298775 | Ga0466709_298775_922_2220 | 432 |
| 135 | iso_pr_bacteria | 2940202316 | 2940202752 | 432 |
| 136 | 3300042599 | Ga0466706_134925 | Ga0466706_134925_6729_8030 | 433 |
| 137 | 3300042601 | Ga0466707_044234 | Ga0466707_044234_2479_3783 | 434 |
| 138 | 3300042601 | Ga0466707_213366 | Ga0466707_213366_911_2215 | 434 |
| 139 | 3300042602 | Ga0466713_093846 | Ga0466713_093846_39638_40942 | 434 |
| 140 | 3300042615 | Ga0466711_451493 | Ga0466711_451493_5991_7295 | 434 |
| 141 | 3300042648 | Ga0466709_328692 | Ga0466709_328692_34438_35742 | 434 |
| 142 | 3300005083 | Ga0068305_10172136 | Ga0068305_101721363 | 435 |
| 143 | 3300042593 | Ga0466691_050053 | Ga0466691_050053_1948_3306 | 435 |
| 144 | 3300042603 | Ga0466714_008609 | Ga0466714_008609_670_1977 | 435 |
| 145 | 3300042611 | Ga0466697_176725 | Ga0466697_176725_1646_2953 | 435 |
| 146 | 3300042603 | Ga0466714_159678 | Ga0466714_159678_10841_12151 | 436 |
| 147 | 3300042593 | Ga0466691_023019 | Ga0466691_023019_3292_4608 | 438 |
| 148 | 3300042643 | Ga0466704_216571 | Ga0466704_216571_5391_6707 | 438 |
| 149 | 3300000062 | IMNBL1DRAFT_c0000059 | IMNBL1DRAFT_000005980 | 439 |
| 150 | 3300042596 | Ga0466696_496124 | Ga0466696_496124_255_1589 | 444 |
| 151 | 3300042618 | Ga0466723_141568 | Ga0466723_141568_1731_3065 | 444 |
| 152 | 3300042643 | Ga0466704_502176 | Ga0466704_502176_105_1457 | 450 |
| 153 | 3300042590 | Ga0466690_354941 | Ga0466690_354941_21607_22986 | 459 |
| 154 | 3300042659 | Ga0466733_141558 | Ga0466733_141558_7367_8746 | 459 |
| 155 | 3300042624 | Ga0466735_222090 | Ga0466735_222090_462_1853 | 463 |
| 156 | 2225789004 | 2227155811 | 2227563519 | 467 |
| 157 | 3300042603 | Ga0466714_075303 | Ga0466714_075303_3208_4632 | 474 |
| 158 | 3300042618 | Ga0466723_064929 | Ga0466723_064929_466_1974 | 475 |
| 159 | 3300042602 | Ga0466713_033702 | Ga0466713_033702_15413_16852 | 479 |
| 160 | 3300042619 | Ga0466726_224822 | Ga0466726_224822_83_1612 | 509 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.89 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.