Protein Family IF08266

Metagenome Isolate
160 Members
83 Samples
113 Scaffolds
429.94 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_224822|Ga0466726_224822_83_1612
Length
509 aa
Sequence
MTEPLHSDSNTVIVDVRTTEEFFGGHIDKSVNIPLEKIVSSVENLKKYDNIIIVCASGKRSAQAKSILEGEGLKNVHDGGGCQNFYETQQIIALIKREVVPAIGCTEPVAVAFAVAKAKEILGCLPEKIDVSLSANVLKNAMGVGIPGTGMIGLPIAIALGAITGKSEYGLEVLKDITNNALEQGKKMIEEKKINISLCENAPNQLYIATTVKNGSESVKVVVCEEHTKIVRIEKNGKTIFEEKISPAEENNTEITQTLSMRKVYDFAMETPTDDIKFILEAAKINSAAAEKALNMSYGHSLGRTMTGIYEHQIMGDSMLSKILAYTSSACDARMGGAMIPVMTNSGSGNQGITATLPVAVFAREMKKSEEQLIRALILSSLTVIYIKQSMGRLSALCGCVVASTGSACGITYLMGGGYEQICYAVKNMVANLAGMVCDGAKPSCSLKVSSSAATAVFSAMMAMEGKFVKSVEGIIDNDVDKSIHNLTRIASSGMCETDKMILEIMTGK

📊 Sample Types

Isolate 29.4%
Metagenome 70.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 50.0%
Kalotermitidae 17.1%
Termitidae 13.4%
Unclassified 8.5%
Rhinotermitidae 3.7%
Termopsidae 3.7%
Passalidae 2.4%
Hodotermitidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 157
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
2 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
3 2922326829 Bacteroides sp. 224 Isolate Blattidae
4 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
5 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
6 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
7 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
8 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
9 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
10 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
11 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
12 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
13 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
14 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
15 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
16 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
17 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
18 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
19 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
20 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
21 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
22 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
23 3004677695 Bacteroides sp. 214 Isolate Blattidae
24 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
25 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
26 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
27 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
28 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
29 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
30 3004667792 Bacteroides sp. 519 Isolate Blattidae
31 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
32 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
33 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
34 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
35 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
36 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
37 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
38 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
39 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
40 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
41 3004672520 Bacteroides sp. 51 Isolate Blattidae
42 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
43 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
44 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
45 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
46 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
47 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
48 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
49 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
50 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
51 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
52 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
53 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
54 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
55 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
56 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
57 2923982719 Parabacteroides sp. 52 Isolate Blattidae
58 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
59 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
60 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
61 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
62 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
63 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
64 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
65 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
66 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
67 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
68 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
69 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
70 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
71 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
72 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
73 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
74 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
75 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
76 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
77 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
78 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
79 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
80 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
81 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
82 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
83 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_185873 3300042612 Bacteria 9001
2 Ga0466733_141558 3300042659 Bacteria 10167
3 IMNBL1DRAFT_c0001443 3300000062 Bacteria 17766
4 Ga0466691_095246 3300042593 Bacteria 18091
5 Ga0466691_099055 3300042593 Bacteria 3675
6 Ga0466703_367008 3300042636 Bacteria 30950
7 Ga0466706_134925 3300042599 Bacteria 10927
8 Ga0466707_213366 3300042601 Bacteria 3914
9 Ga0466713_041499 3300042602 Bacteria 101217
10 Ga0466714_008609 3300042603 Bacteria 4341
11 Ga0466717_083168 3300042604 Bacteria 1553
12 Ga0466733_055750 3300042659 Bacteria 12185
13 Ga0466705_494792 3300042612 Bacteria 3038
14 Ga0466711_451493 3300042615 Bacteria 10844
15 Ga0466715_170026 3300042616 Bacteria 29950
16 Ga0466731_088179 3300042622 Bacteria 4690
17 Ga0466735_002261 3300042624 Bacteria 2668
18 Ga0466704_189809 3300042643 Bacteria 10799
19 Ga0466709_081332 3300042648 Unclassified 50852
20 Ga0466709_298775 3300042648 Bacteria 18829
21 Ga0466709_328692 3300042648 Bacteria 228895
22 Ga0466708_225726 3300042652 Bacteria 5929
23 Ga0466706_028005 3300042599 Bacteria 12952
24 Ga0466706_034191 3300042599 Bacteria 44289
25 Ga0466706_163481 3300042599 Bacteria 45216
26 Ga0466707_296253 3300042601 Bacteria 25031
27 Ga0466713_009775 3300042602 Bacteria 66246
28 Ga0466713_020351 3300042602 Bacteria 91390
29 Ga0466733_061316 3300042659 Bacteria 145079
30 Ga0466710_032215 3300042613 Bacteria 1496
31 Ga0466711_114294 3300042615 Bacteria 16823
32 Ga0466711_350231 3300042615 Bacteria 5994
33 Ga0466726_224822 3300042619 Bacteria 3003
34 Ga0466691_023019 3300042593 Bacteria 12671
35 Ga0466691_050053 3300042593 Bacteria 6806
36 Ga0466691_163996 3300042593 Bacteria 6431
37 Ga0466696_049113 3300042596 Bacteria 63300
38 Ga0466696_190653 3300042596 Bacteria 1472
39 Ga0466714_099856 3300042603 Bacteria 26552
40 Ga0466719_124633 3300042606 Bacteria 9034
41 Ga0466705_124204 3300042612 Bacteria 47476
42 Ga0466705_212723 3300042612 Bacteria 3592
43 IMNBL1DRAFT_c0000059 3300000062 Bacteria 103534
44 IMNBL1DRAFT_c0013142 3300000062 Bacteria 3736
45 JGI24702J35022_10105898 3300002462 Bacteria 1543
46 Ga0466715_045980 3300042616 Bacteria 33517
47 Ga0160452_100659 3300012834 Bacteria 17948
48 Ga0466696_070746 3300042596 Bacteria 74081
49 Ga0466696_136965 3300042596 Bacteria 5525
50 Ga0466696_251801 3300042596 Bacteria 32029
51 Ga0466735_217815 3300042624 Bacteria 1768
52 Ga0466724_50759 3300042649 Bacteria 4502
53 Ga0466727_215099 3300042655 Bacteria 1655
54 Ga0466713_051288 3300042602 Bacteria 230715
55 Ga0466713_143155 3300042602 Bacteria 188721
56 Ga0466714_075303 3300042603 Bacteria 17951
57 Ga0466716_056469 3300042605 Bacteria 5667
58 Ga0466697_176725 3300042611 Bacteria 2995
59 Ga0466733_094314 3300042659 Unclassified 1707
60 Ga0466715_440066 3300042616 Bacteria 13179
61 Ga0466723_064929 3300042618 Bacteria 41064
62 Ga0466728_044515 3300042620 Bacteria 5778
63 Ga0466728_192677 3300042620 Bacteria 2484
64 Ga0466729_038665 3300042621 Bacteria 15259
65 Ga0466690_225246 3300042590 Bacteria 6354
66 Ga0466691_163200 3300042593 Bacteria 4992
67 Ga0466696_496124 3300042596 Bacteria 2353
68 Ga0466703_242939 3300042636 Bacteria 13750
69 Ga0466704_235767 3300042643 Bacteria 4757
70 Ga0466708_027130 3300042652 Bacteria 4645
71 Ga0466708_139052 3300042652 Bacteria 5245
72 Ga0466706_138933 3300042599 Bacteria 6203
73 Ga0466707_044234 3300042601 Bacteria 8494
74 Ga0466713_033702 3300042602 Bacteria 18682
75 Ga0466713_052484 3300042602 Bacteria 51192
76 Ga0466714_159678 3300042603 Bacteria 13291
77 Ga0466716_011142 3300042605 Bacteria 3530
78 IMNBL1DRAFT_c0000937 3300000062 Bacteria 22532
79 Ga0466723_141568 3300042618 Bacteria 16577
80 Ga0466657_273247 3300042582 Bacteria 4220
81 Ga0466735_078756 3300042624 Bacteria 2833
82 Ga0466735_127512 3300042624 Bacteria 15862
83 Ga0466706_171746 3300042599 Bacteria 69301
84 Ga0466707_012189 3300042601 Bacteria 5935
85 Ga0068305_10172136 3300005083 Unclassified 4668
86 Ga0466711_092017 3300042615 Bacteria 9384
87 Ga0466711_494046 3300042615 Bacteria 3696
88 Ga0466715_066044 3300042616 Bacteria 3702
89 Ga0466723_023030 3300042618 Bacteria 16011
90 Ga0466690_180282 3300042590 Bacteria 25954
91 Ga0466694_321800 3300042594 Bacteria 29415
92 Ga0466695_212656 3300042595 Bacteria 4744
93 Ga0466703_225503 3300042636 Bacteria 9103
94 Ga0466704_216571 3300042643 Bacteria 9337
95 Ga0466704_446923 3300042643 Bacteria 3231
96 Ga0466704_502176 3300042643 Bacteria 1835
97 Ga0466706_037437 3300042599 Bacteria 17939
98 Ga0466706_121012 3300042599 Bacteria 39559
99 2227155811 2225789004 Bacteria 8444
100 IMNBL1DRAFT_c0005049 3300000062 Bacteria 7687
101 Ga0466710_107103 3300042613 Bacteria 16718
102 Ga0466711_023837 3300042615 Bacteria 62988
103 Ga0466715_111811 3300042616 Bacteria 33974
104 Ga0466715_165372 3300042616 Bacteria 16231
105 Ga0466690_354941 3300042590 Bacteria 44034
106 Ga0466696_113588 3300042596 Bacteria 6004
107 Ga0466729_264172 3300042621 Bacteria 5257
108 Ga0466735_222090 3300042624 Bacteria 5320
109 Ga0466709_017802 3300042648 Bacteria 72752
110 Ga0466706_027208 3300042599 Bacteria 10452
111 Ga0466707_112391 3300042601 Bacteria 11861
112 Ga0466713_093396 3300042602 Bacteria 9732
113 Ga0466713_093846 3300042602 Bacteria 70842

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042622 Ga0466731_088179 Ga0466731_088179_1878_3155 401
2 3300042593 Ga0466691_163996 Ga0466691_163996_159_1454 408
3 3300042618 Ga0466723_023030 Ga0466723_023030_427_1707 409
4 3300042601 Ga0466707_012189 Ga0466707_012189_4598_5884 410
5 3300042601 Ga0466707_296253 Ga0466707_296253_920_2200 410
6 3300042649 Ga0466724_50759 Ga0466724_50759_2778_4061 410
7 3300042613 Ga0466710_032215 Ga0466710_032215_232_1473 413
8 3300042621 Ga0466729_264172 Ga0466729_264172_1955_3238 413
9 3300042596 Ga0466696_136965 Ga0466696_136965_2628_3875 415
10 3300042599 Ga0466706_027208 Ga0466706_027208_5836_7122 415
11 3300002462 JGI24702J35022_10105898 JGI24702J35022_101058982 417
12 3300042602 Ga0466713_143155 Ga0466713_143155_167158_168441 417
13 3300042648 Ga0466709_081332 Ga0466709_081332_8524_9807 417
14 3300042602 Ga0466713_041499 Ga0466713_041499_71070_72356 419
15 3300042615 Ga0466711_494046 Ga0466711_494046_2373_3656 421
16 3300042593 Ga0466691_163200 Ga0466691_163200_3212_4483 423
17 3300042602 Ga0466713_093396 Ga0466713_093396_371_1642 423
18 3300042624 Ga0466735_217815 Ga0466735_217815_273_1544 423
19 iso_pr_bacteria 3004667792 3004667947 423
20 3300042606 Ga0466719_124633 Ga0466719_124633_7359_8633 424
21 3300042615 Ga0466711_023837 Ga0466711_023837_42639_43913 424
22 3300042616 Ga0466715_066044 Ga0466715_066044_301_1575 424
23 3300042601 Ga0466707_112391 Ga0466707_112391_7621_8898 425
24 3300042593 Ga0466691_099055 Ga0466691_099055_1686_2966 426
25 3300042596 Ga0466696_049113 Ga0466696_049113_45200_46480 426
26 3300042596 Ga0466696_113588 Ga0466696_113588_2910_4190 426
27 3300042602 Ga0466713_052484 Ga0466713_052484_3915_5195 426
28 3300042603 Ga0466714_099856 Ga0466714_099856_20400_21719 426
29 3300042605 Ga0466716_056469 Ga0466716_056469_2896_4176 426
30 3300042621 Ga0466729_038665 Ga0466729_038665_7286_8566 426
31 3300042624 Ga0466735_127512 Ga0466735_127512_8112_9392 426
32 3300042652 Ga0466708_027130 Ga0466708_027130_571_1851 426
33 iso_pr_bacteria 2940380068 2940382077 426
34 iso_pr_bacteria 2940386776 2940389050 426
35 iso_pr_bacteria 2940393498 2940395501 426
36 iso_pr_bacteria 2940400224 2940402501 426
37 iso_pr_bacteria 2940406939 2940406976 426
38 iso_pr_bacteria 3004672520 3004672731 426
39 iso_pr_bacteria 3004677695 3004678444 426
40 3300042593 Ga0466691_095246 Ga0466691_095246_7528_8811 427
41 3300042599 Ga0466706_028005 Ga0466706_028005_4727_6010 427
42 3300042602 Ga0466713_020351 Ga0466713_020351_61821_63104 427
43 3300042604 Ga0466717_083168 Ga0466717_083168_237_1520 427
44 3300042612 Ga0466705_185873 Ga0466705_185873_4089_5372 427
45 3300042613 Ga0466710_107103 Ga0466710_107103_11728_13011 427
46 3300042616 Ga0466715_440066 Ga0466715_440066_6588_7871 427
47 3300042636 Ga0466703_225503 Ga0466703_225503_1655_2938 427
48 3300042652 Ga0466708_139052 Ga0466708_139052_1787_3070 427
49 3300042659 Ga0466733_061316 Ga0466733_061316_14879_16162 427
50 3300042659 Ga0466733_094314 Ga0466733_094314_141_1424 427
51 iso_pr_bacteria 2695420314 2695470870 427
52 iso_pr_bacteria 2910942425 2910945557 427
53 iso_pr_bacteria 2922326829 2922327550 427
54 iso_pr_bacteria 2940244548 2940246145 427
55 iso_pr_bacteria 2940248789 2940249969 427
56 iso_pr_bacteria 2940253009 2940254043 427
57 iso_pr_bacteria 2940257232 2940258211 427
58 iso_pr_bacteria 8100166142 8100168532 427
59 3300000062 IMNBL1DRAFT_c0001443 IMNBL1DRAFT_00014437 428
60 3300000062 IMNBL1DRAFT_c0013142 IMNBL1DRAFT_00131422 428
61 3300042582 Ga0466657_273247 Ga0466657_273247_1421_2707 428
62 3300042594 Ga0466694_321800 Ga0466694_321800_25656_26942 428
63 3300042595 Ga0466695_212656 Ga0466695_212656_1273_2559 428
64 3300042596 Ga0466696_251801 Ga0466696_251801_27443_28729 428
65 3300042599 Ga0466706_037437 Ga0466706_037437_15285_16571 428
66 3300042599 Ga0466706_163481 Ga0466706_163481_31280_32566 428
67 3300042612 Ga0466705_212723 Ga0466705_212723_1273_2559 428
68 3300042615 Ga0466711_114294 Ga0466711_114294_1957_3243 428
69 3300042616 Ga0466715_045980 Ga0466715_045980_253_1539 428
70 3300042616 Ga0466715_111811 Ga0466715_111811_23868_25154 428
71 3300042652 Ga0466708_225726 Ga0466708_225726_2197_3483 428
72 3300042655 Ga0466727_215099 Ga0466727_215099_189_1475 428
73 3300042659 Ga0466733_055750 Ga0466733_055750_1044_2330 428
74 iso_pr_bacteria 2820792843 2820793350 428
75 iso_pr_bacteria 2820795054 2820797525 428
76 iso_pr_bacteria 2910926975 2910926984 428
77 iso_pr_bacteria 2910959314 2910960645 428
78 iso_pr_bacteria 2923982719 2923984761 428
79 iso_pr_bacteria 2940371297 2940372448 428
80 3300000062 IMNBL1DRAFT_c0000937 IMNBL1DRAFT_00009375 429
81 3300042599 Ga0466706_121012 Ga0466706_121012_22212_23501 429
82 3300042602 Ga0466713_051288 Ga0466713_051288_130202_131491 429
83 3300042615 Ga0466711_350231 Ga0466711_350231_2196_3485 429
84 3300042624 Ga0466735_078756 Ga0466735_078756_800_2089 429
85 3300042648 Ga0466709_017802 Ga0466709_017802_53814_55103 429
86 iso_pr_bacteria 2940193328 2940193426 429
87 iso_pr_bacteria 2940195863 2940198908 429
88 iso_pr_bacteria 2940199050 2940201651 429
89 iso_pr_bacteria 2940205530 2940206449 429
90 iso_pr_bacteria 2940209341 2940209944 429
91 iso_pr_bacteria 2940212447 2940213276 429
92 iso_pr_bacteria 2940221333 2940222476 429
93 iso_pr_bacteria 2940298504 2940299420 429
94 iso_pr_bacteria 2940302308 2940303137 429
95 iso_pr_bacteria 2940306115 2940306949 429
96 iso_pr_bacteria 2940309933 2940310766 429
97 iso_pr_bacteria 2940313741 2940314519 429
98 iso_pr_bacteria 2940317558 2940318333 429
99 iso_pr_bacteria 2940321370 2940322146 429
100 iso_pr_bacteria 2940325180 2940326009 429
101 iso_pr_bacteria 2940328985 2940329903 429
102 iso_pr_bacteria 2940332795 2940333629 429
103 iso_pr_bacteria 2940336608 2940336705 429
104 iso_pr_bacteria 2940346213 2940348557 429
105 iso_pr_bacteria 2940413413 2940416071 429
106 iso_pr_bacteria 2940419646 2940422631 429
107 iso_pr_bacteria 2940425923 2940428438 429
108 3300012834 Ga0160452_100659 Ga0160452_10065914 430
109 3300042596 Ga0466696_070746 Ga0466696_070746_42648_43940 430
110 3300042599 Ga0466706_138933 Ga0466706_138933_4888_6180 430
111 3300042599 Ga0466706_171746 Ga0466706_171746_63046_64338 430
112 3300042605 Ga0466716_011142 Ga0466716_011142_847_2139 430
113 3300042612 Ga0466705_494792 Ga0466705_494792_187_1479 430
114 3300042620 Ga0466728_192677 Ga0466728_192677_838_2130 430
115 3300042624 Ga0466735_002261 Ga0466735_002261_994_2286 430
116 3300042636 Ga0466703_367008 Ga0466703_367008_10628_11920 430
117 iso_pr_bacteria 2609459943 2610743187 430
118 iso_pr_bacteria 2830041218 2830041384 430
119 3300000062 IMNBL1DRAFT_c0005049 IMNBL1DRAFT_00050494 431
120 3300042590 Ga0466690_180282 Ga0466690_180282_19073_20368 431
121 3300042596 Ga0466696_190653 Ga0466696_190653_162_1457 431
122 3300042599 Ga0466706_034191 Ga0466706_034191_10349_11644 431
123 3300042602 Ga0466713_009775 Ga0466713_009775_35576_36871 431
124 3300042612 Ga0466705_124204 Ga0466705_124204_37696_38991 431
125 3300042615 Ga0466711_092017 Ga0466711_092017_945_2240 431
126 3300042616 Ga0466715_170026 Ga0466715_170026_17517_18812 431
127 3300042620 Ga0466728_044515 Ga0466728_044515_1551_2846 431
128 3300042636 Ga0466703_242939 Ga0466703_242939_3723_5018 431
129 3300042643 Ga0466704_189809 Ga0466704_189809_5210_6505 431
130 3300042643 Ga0466704_235767 Ga0466704_235767_1347_2642 431
131 3300042643 Ga0466704_446923 Ga0466704_446923_136_1431 431
132 3300042590 Ga0466690_225246 Ga0466690_225246_4400_5698 432
133 3300042616 Ga0466715_165372 Ga0466715_165372_7389_8687 432
134 3300042648 Ga0466709_298775 Ga0466709_298775_922_2220 432
135 iso_pr_bacteria 2940202316 2940202752 432
136 3300042599 Ga0466706_134925 Ga0466706_134925_6729_8030 433
137 3300042601 Ga0466707_044234 Ga0466707_044234_2479_3783 434
138 3300042601 Ga0466707_213366 Ga0466707_213366_911_2215 434
139 3300042602 Ga0466713_093846 Ga0466713_093846_39638_40942 434
140 3300042615 Ga0466711_451493 Ga0466711_451493_5991_7295 434
141 3300042648 Ga0466709_328692 Ga0466709_328692_34438_35742 434
142 3300005083 Ga0068305_10172136 Ga0068305_101721363 435
143 3300042593 Ga0466691_050053 Ga0466691_050053_1948_3306 435
144 3300042603 Ga0466714_008609 Ga0466714_008609_670_1977 435
145 3300042611 Ga0466697_176725 Ga0466697_176725_1646_2953 435
146 3300042603 Ga0466714_159678 Ga0466714_159678_10841_12151 436
147 3300042593 Ga0466691_023019 Ga0466691_023019_3292_4608 438
148 3300042643 Ga0466704_216571 Ga0466704_216571_5391_6707 438
149 3300000062 IMNBL1DRAFT_c0000059 IMNBL1DRAFT_000005980 439
150 3300042596 Ga0466696_496124 Ga0466696_496124_255_1589 444
151 3300042618 Ga0466723_141568 Ga0466723_141568_1731_3065 444
152 3300042643 Ga0466704_502176 Ga0466704_502176_105_1457 450
153 3300042590 Ga0466690_354941 Ga0466690_354941_21607_22986 459
154 3300042659 Ga0466733_141558 Ga0466733_141558_7367_8746 459
155 3300042624 Ga0466735_222090 Ga0466735_222090_462_1853 463
156 2225789004 2227155811 2227563519 467
157 3300042603 Ga0466714_075303 Ga0466714_075303_3208_4632 474
158 3300042618 Ga0466723_064929 Ga0466723_064929_466_1974 475
159 3300042602 Ga0466713_033702 Ga0466713_033702_15413_16852 479
160 3300042619 Ga0466726_224822 Ga0466726_224822_83_1612 509

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00581 Rhodanese Rhodanese-like domain 7 77 0.91
PF03313 SDH_alpha Serine dehydratase alpha chain 168 504 0.88

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.