Protein Family IF08263

Metagenome Isolate
141 Members
43 Samples
133 Scaffolds
193.4 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_217236|Ga0466726_217236_59453_60091
Length
212 aa
Sequence
VLLVWVFHLYVCDIKGVLMMSAKMIEIRWHGRGGQGAKTAALLFAEVVLATGKHIQAFPEYGPERMGAPVQAFNRISDENITIHSGITNPDYVVILDPSLMESVEVIDGVGEIGKVIVNTSFTVAKIAQKLGIKESQIYVVNASQIALETIGKDIPNTPMLGGLVKVIGTLDINSVLEDIKGKLMSKFRHKPEIIDGNVKSIKRAFDEVKNR

📊 Sample Types

Isolate 5.7%
Metagenome 94.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 31.0%
Unclassified 26.2%
Termitidae 23.8%
Termopsidae 9.5%
Rhinotermitidae 4.8%
Hodotermitidae 2.4%
Passalidae 2.4%

🌳 Taxonomy

Archaea 0
Bacteria 121
Eukaryota 0
Viruses 0
Unclassified 20

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2772190889 Unclassified Elusimicrobia Cu122P5_bin43 Isolate Unclassified
2 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
6 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
7 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
8 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
9 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
10 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
11 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
12 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
13 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
14 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
15 2772190891 Unclassified Elusimicrobia Emb289P1_bin41 Isolate Unclassified
16 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
17 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
18 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
19 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
20 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
21 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
22 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
23 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
24 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
25 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
26 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
27 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
28 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
29 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
30 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
31 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
32 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
33 642555172 Endomicrobium trichonymphae Rs-D17 Isolate Unclassified
34 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
35 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
36 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
37 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
38 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
39 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
40 2772190893 Unclassified Elusimicrobia Nt197P4_bin29 Isolate Unclassified
41 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
42 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
43 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123357_10006932 3300009784 Bacteria 13921
2 Ga0466690_246607 3300042590 Bacteria 5762
3 Ga0466690_324640 3300042590 Unclassified 4856
4 Ga0466707_082963 3300042601 Unclassified 1094
5 Ga0466707_127045 3300042601 Bacteria 82449
6 Ga0466719_005808 3300042606 Bacteria 6406
7 Ga0466715_103093 3300042616 Bacteria 32574
8 Ga0466715_464428 3300042616 Bacteria 2260
9 Ga0466718_057353 3300042617 Unclassified 12564
10 Ga0466723_276653 3300042618 Bacteria 86412
11 Ga0466723_350099 3300042618 Bacteria 10749
12 Ga0466726_219448 3300042619 Bacteria 3246
13 Ga0466728_003045 3300042620 Bacteria 90142
14 Ga0466728_417467 3300042620 Bacteria 43739
15 Ga0466729_138882 3300042621 Bacteria 1908
16 Ga0466705_187150 3300042612 Unclassified 3476
17 Ga0466735_062663 3300042624 Unclassified 1459
18 Ga0466735_062677 3300042624 Bacteria 17462
19 Ga0466735_202494 3300042624 Bacteria 11764
20 Ga0466704_596461 3300042643 Bacteria 93141
21 JGI24705J35276_12238808 3300002504 Bacteria 121301
22 Ga0068302_10068148 3300005071 Bacteria 4342
23 Ga0068305_10000168 3300005083 Bacteria 304006
24 Ga0466706_166478 3300042599 Bacteria 103376
25 Ga0466707_296529 3300042601 Bacteria 3870
26 Ga0466719_040767 3300042606 Bacteria 242892
27 Ga0466712_236422 3300042614 Bacteria 1383
28 Ga0466715_602591 3300042616 Bacteria 13927
29 Ga0466726_395759 3300042619 Bacteria 8049
30 Ga0466726_400574 3300042619 Bacteria 12909
31 Ga0466729_015754 3300042621 Bacteria 6777
32 Ga0466729_119788 3300042621 Bacteria 59579
33 Ga0466705_143986 3300042612 Bacteria 113378
34 Ga0466735_235213 3300042624 Bacteria 12597
35 Ga0466704_551659 3300042643 Unclassified 1358
36 Ga0466727_017964 3300042655 Unclassified 1672
37 Ga0466727_214209 3300042655 Bacteria 66628
38 Ga0466691_015920 3300042593 Bacteria 62881
39 Ga0068302_10016289 3300005071 Unclassified 4443
40 Ga0466707_237788 3300042601 Bacteria 14513
41 Ga0466711_157498 3300042615 Bacteria 313285
42 Ga0466711_190200 3300042615 Bacteria 3480
43 Ga0466723_061356 3300042618 Bacteria 3229
44 Ga0466728_334452 3300042620 Bacteria 73486
45 Ga0466729_155428 3300042621 Bacteria 41381
46 Ga0466735_023872 3300042624 Bacteria 8242
47 Ga0466704_095429 3300042643 Bacteria 32723
48 Ga0466704_270377 3300042643 Bacteria 7319
49 Ga0466727_271147 3300042655 Bacteria 176023
50 Ga0466693_222853 3300042592 Bacteria 3744
51 Ga0466696_069943 3300042596 Bacteria 19845
52 Ga0068302_10032838 3300005071 Bacteria 3103
53 Ga0072941_1146420 3300005201 Bacteria 3385
54 Ga0466706_217033 3300042599 Bacteria 132615
55 Ga0466713_089799 3300042602 Bacteria 8648
56 Ga0466716_137771 3300042605 Bacteria 19371
57 Ga0466705_463812 3300042612 Bacteria 8007
58 Ga0466711_072268 3300042615 Bacteria 16190
59 Ga0466723_351486 3300042618 Bacteria 3625
60 Ga0466729_016394 3300042621 Bacteria 6635
61 Ga0466735_013899 3300042624 Bacteria 1484
62 Ga0466735_027740 3300042624 Bacteria 1055
63 Ga0466735_071145 3300042624 Bacteria 4458
64 Ga0466703_003589 3300042636 Unclassified 3709
65 Ga0123353_10000467 3300010167 Bacteria 50553
66 Ga0466690_401128 3300042590 Bacteria 8215
67 Ga0466706_010205 3300042599 Bacteria 97987
68 Ga0466706_037575 3300042599 Bacteria 87054
69 Ga0466713_009206 3300042602 Bacteria 8464
70 Ga0466713_024871 3300042602 Bacteria 17138
71 Ga0466710_048869 3300042613 Bacteria 1199
72 Ga0466715_163831 3300042616 Bacteria 66780
73 Ga0466723_305406 3300042618 Unclassified 3141
74 Ga0466726_229723 3300042619 Bacteria 11448
75 Ga0466726_435703 3300042619 Bacteria 1321
76 Ga0466735_013528 3300042624 Bacteria 15782
77 Ga0466703_250320 3300042636 Bacteria 592480
78 Ga0466704_282522 3300042643 Unclassified 12374
79 Ga0466709_217350 3300042648 Bacteria 27425
80 Ga0466727_059455 3300042655 Bacteria 175715
81 Ga0123356_10000082 3300010049 Bacteria 101862
82 Ga0466696_452776 3300042596 Bacteria 6688
83 Ga0068305_10000309 3300005083 Bacteria 29885
84 Ga0466706_101820 3300042599 Bacteria 1433
85 Ga0466707_096790 3300042601 Bacteria 31095
86 Ga0466722_131165 3300042609 Bacteria 4278
87 Ga0466705_426510 3300042612 Unclassified 13528
88 Ga0466711_242327 3300042615 Bacteria 45441
89 Ga0466711_353417 3300042615 Bacteria 10016
90 Ga0466715_006925 3300042616 Bacteria 24708
91 Ga0466715_135271 3300042616 Bacteria 38838
92 Ga0466715_289200 3300042616 Unclassified 3460
93 Ga0466726_100940 3300042619 Bacteria 1689
94 Ga0466726_383206 3300042619 Unclassified 5067
95 Ga0466728_089839 3300042620 Bacteria 15970
96 Ga0466735_057599 3300042624 Bacteria 16673
97 Ga0466704_448201 3300042643 Bacteria 6498
98 Ga0466690_048667 3300042590 Unclassified 4006
99 Ga0466690_309270 3300042590 Bacteria 28660
100 JGI24702J35022_10000059 3300002462 Bacteria 46281
101 Ga0068305_10000090 3300005083 Bacteria 152414
102 Ga0466713_148925 3300042602 Bacteria 109604
103 Ga0466714_064782 3300042603 Bacteria 70661
104 Ga0466716_246458 3300042605 Bacteria 14023
105 Ga0466719_014293 3300042606 Unclassified 12744
106 Ga0466726_041114 3300042619 Bacteria 30700
107 Ga0466726_115500 3300042619 Bacteria 71251
108 Ga0466726_217236 3300042619 Bacteria 220873
109 Ga0466726_293088 3300042619 Bacteria 1402
110 Ga0466729_202955 3300042621 Bacteria 12259
111 Ga0466735_074455 3300042624 Bacteria 27644
112 Ga0466735_153156 3300042624 Bacteria 11109
113 Ga0466735_185288 3300042624 Unclassified 7397
114 Ga0466704_086571 3300042643 Bacteria 65985
115 Ga0466727_067057 3300042655 Bacteria 7765
116 Ga0123357_10033735 3300009784 Bacteria 6958
117 Ga0123353_11233160 3300010167 Bacteria 978
118 Ga0466691_005214 3300042593 Unclassified 3568
119 2227487433 2225789004 Bacteria 4198
120 Ga0068302_10032860 3300005071 Bacteria 6812
121 Ga0068305_10003706 3300005083 Unclassified 16582
122 Ga0466706_155976 3300042599 Bacteria 20238
123 Ga0466707_031574 3300042601 Bacteria 5078
124 Ga0466707_141553 3300042601 Bacteria 8298
125 Ga0466719_524336 3300042606 Bacteria 382683
126 Ga0466711_372501 3300042615 Bacteria 489210
127 Ga0466715_098538 3300042616 Bacteria 131452
128 Ga0466705_137618 3300042612 Bacteria 19455
129 Ga0466735_061923 3300042624 Bacteria 10833
130 Ga0466735_063588 3300042624 Bacteria 1406
131 Ga0466703_002301 3300042636 Bacteria 33125
132 Ga0466704_026920 3300042643 Unclassified 5134
133 Ga0466727_322139 3300042655 Bacteria 101886

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042624 Ga0466735_027740 Ga0466735_027740_553_1044 163
2 3300042590 Ga0466690_401128 Ga0466690_401128_6489_7073 177
3 3300042612 Ga0466705_143986 Ga0466705_143986_15814_16395 182
4 3300042624 Ga0466735_185288 Ga0466735_185288_6652_7230 185
5 3300042620 Ga0466728_003045 Ga0466728_003045_8577_9143 188
6 3300042620 Ga0466728_089839 Ga0466728_089839_11940_12527 188
7 3300042655 Ga0466727_271147 Ga0466727_271147_126493_127059 188
8 iso_pr_bacteria 642555172 642791061 188
9 3300042601 Ga0466707_296529 Ga0466707_296529_2524_3093 189
10 3300042643 Ga0466704_095429 Ga0466704_095429_7980_8555 191
11 3300042596 Ga0466696_069943 Ga0466696_069943_10454_11032 192
12 3300042601 Ga0466707_082963 Ga0466707_082963_117_695 192
13 3300042601 Ga0466707_096790 Ga0466707_096790_7051_7629 192
14 3300042601 Ga0466707_127045 Ga0466707_127045_81462_82040 192
15 3300042602 Ga0466713_009206 Ga0466713_009206_3657_4235 192
16 3300042602 Ga0466713_024871 Ga0466713_024871_7562_8140 192
17 3300042602 Ga0466713_148925 Ga0466713_148925_90713_91291 192
18 3300042606 Ga0466719_040767 Ga0466719_040767_206962_207540 192
19 3300042606 Ga0466719_524336 Ga0466719_524336_315365_315943 192
20 3300042615 Ga0466711_072268 Ga0466711_072268_4193_4771 192
21 3300042615 Ga0466711_190200 Ga0466711_190200_237_815 192
22 3300042615 Ga0466711_353417 Ga0466711_353417_4659_5237 192
23 3300042615 Ga0466711_372501 Ga0466711_372501_109346_109924 192
24 3300042616 Ga0466715_098538 Ga0466715_098538_4424_5002 192
25 3300042616 Ga0466715_464428 Ga0466715_464428_153_731 192
26 3300042619 Ga0466726_100940 Ga0466726_100940_984_1562 192
27 3300042619 Ga0466726_115500 Ga0466726_115500_27505_28083 192
28 3300042621 Ga0466729_015754 Ga0466729_015754_1997_2575 192
29 3300042621 Ga0466729_119788 Ga0466729_119788_43532_44110 192
30 3300042621 Ga0466729_202955 Ga0466729_202955_8422_9000 192
31 3300042624 Ga0466735_057599 Ga0466735_057599_6839_7417 192
32 3300042624 Ga0466735_063588 Ga0466735_063588_22_600 192
33 3300042624 Ga0466735_074455 Ga0466735_074455_7252_7830 192
34 3300042624 Ga0466735_153156 Ga0466735_153156_9535_10113 192
35 3300042624 Ga0466735_202494 Ga0466735_202494_6336_6914 192
36 3300042624 Ga0466735_235213 Ga0466735_235213_6060_6638 192
37 3300042636 Ga0466703_002301 Ga0466703_002301_4068_4646 192
38 3300042636 Ga0466703_250320 Ga0466703_250320_462196_462774 192
39 3300042643 Ga0466704_270377 Ga0466704_270377_5247_5825 192
40 3300042655 Ga0466727_059455 Ga0466727_059455_125493_126071 192
41 3300042655 Ga0466727_214209 Ga0466727_214209_49483_50061 192
42 iso_pr_bacteria 2754412482 2755215533 192
43 iso_pr_bacteria 2772190891 2773434037 192
44 iso_pr_bacteria 2772190893 2773438378 192
45 iso_pr_bacteria 2772190894 2773438787 192
46 2225789004 2227487433 2227955289 193
47 3300002462 JGI24702J35022_10000059 JGI24702J35022_1000005919 193
48 3300002504 JGI24705J35276_12238808 JGI24705J35276_1223880872 193
49 3300005071 Ga0068302_10016289 Ga0068302_100162893 193
50 3300005083 Ga0068305_10000168 Ga0068305_10000168173 193
51 3300005083 Ga0068305_10000309 Ga0068305_1000030919 193
52 3300005083 Ga0068305_10003706 Ga0068305_1000370610 193
53 3300010049 Ga0123356_10000082 Ga0123356_100000827 193
54 3300010167 Ga0123353_11233160 Ga0123353_112331602 193
55 3300042590 Ga0466690_048667 Ga0466690_048667_290_871 193
56 3300042590 Ga0466690_246607 Ga0466690_246607_3456_4037 193
57 3300042593 Ga0466691_005214 Ga0466691_005214_712_1293 193
58 3300042596 Ga0466696_452776 Ga0466696_452776_772_1353 193
59 3300042599 Ga0466706_010205 Ga0466706_010205_37738_38319 193
60 3300042599 Ga0466706_037575 Ga0466706_037575_64625_65206 193
61 3300042599 Ga0466706_101820 Ga0466706_101820_228_809 193
62 3300042599 Ga0466706_155976 Ga0466706_155976_3852_4433 193
63 3300042601 Ga0466707_031574 Ga0466707_031574_2290_2871 193
64 3300042601 Ga0466707_141553 Ga0466707_141553_4660_5241 193
65 3300042601 Ga0466707_237788 Ga0466707_237788_2935_3516 193
66 3300042602 Ga0466713_089799 Ga0466713_089799_6240_6821 193
67 3300042605 Ga0466716_137771 Ga0466716_137771_398_979 193
68 3300042605 Ga0466716_246458 Ga0466716_246458_10228_10809 193
69 3300042606 Ga0466719_005808 Ga0466719_005808_2629_3210 193
70 3300042606 Ga0466719_014293 Ga0466719_014293_8927_9508 193
71 3300042609 Ga0466722_131165 Ga0466722_131165_951_1532 193
72 3300042612 Ga0466705_137618 Ga0466705_137618_9784_10365 193
73 3300042612 Ga0466705_187150 Ga0466705_187150_1851_2432 193
74 3300042612 Ga0466705_463812 Ga0466705_463812_4813_5394 193
75 3300042615 Ga0466711_157498 Ga0466711_157498_238974_239555 193
76 3300042615 Ga0466711_242327 Ga0466711_242327_40367_40948 193
77 3300042616 Ga0466715_163831 Ga0466715_163831_16294_16875 193
78 3300042618 Ga0466723_276653 Ga0466723_276653_17947_18528 193
79 3300042618 Ga0466723_305406 Ga0466723_305406_213_794 193
80 3300042619 Ga0466726_219448 Ga0466726_219448_1063_1644 193
81 3300042619 Ga0466726_229723 Ga0466726_229723_7708_8289 193
82 3300042619 Ga0466726_293088 Ga0466726_293088_344_925 193
83 3300042619 Ga0466726_395759 Ga0466726_395759_2176_2757 193
84 3300042619 Ga0466726_400574 Ga0466726_400574_12271_12852 193
85 3300042619 Ga0466726_435703 Ga0466726_435703_207_788 193
86 3300042620 Ga0466728_334452 Ga0466728_334452_24101_24682 193
87 3300042620 Ga0466728_417467 Ga0466728_417467_12475_13056 193
88 3300042621 Ga0466729_138882 Ga0466729_138882_955_1536 193
89 3300042621 Ga0466729_155428 Ga0466729_155428_2865_3446 193
90 3300042624 Ga0466735_013528 Ga0466735_013528_14772_15353 193
91 3300042624 Ga0466735_023872 Ga0466735_023872_5982_6563 193
92 3300042624 Ga0466735_061923 Ga0466735_061923_9760_10341 193
93 3300042624 Ga0466735_062663 Ga0466735_062663_381_962 193
94 3300042643 Ga0466704_026920 Ga0466704_026920_1425_2006 193
95 3300042643 Ga0466704_086571 Ga0466704_086571_3007_3588 193
96 3300042643 Ga0466704_282522 Ga0466704_282522_3445_4026 193
97 3300042643 Ga0466704_596461 Ga0466704_596461_35421_36002 193
98 3300042648 Ga0466709_217350 Ga0466709_217350_23410_23991 193
99 3300042655 Ga0466727_017964 Ga0466727_017964_309_890 193
100 3300042655 Ga0466727_067057 Ga0466727_067057_7162_7743 193
101 3300042655 Ga0466727_322139 Ga0466727_322139_72646_73227 193
102 3300005071 Ga0068302_10032838 Ga0068302_100328381 194
103 3300005071 Ga0068302_10068148 Ga0068302_100681483 194
104 3300005083 Ga0068305_10000090 Ga0068305_10000090105 194
105 3300009784 Ga0123357_10006932 Ga0123357_100069326 194
106 3300042593 Ga0466691_015920 Ga0466691_015920_59375_59959 194
107 3300042603 Ga0466714_064782 Ga0466714_064782_21737_22321 194
108 3300042616 Ga0466715_135271 Ga0466715_135271_27383_27967 194
109 3300042619 Ga0466726_041114 Ga0466726_041114_15203_15808 194
110 3300042624 Ga0466735_062677 Ga0466735_062677_10138_10722 194
111 iso_pr_bacteria 2754412483 2755217091 194
112 iso_pr_bacteria 2772190889 2773432481 194
113 iso_pr_bacteria 2772190892 2773435934 194
114 3300005071 Ga0068302_10032860 Ga0068302_100328605 195
115 3300009784 Ga0123357_10033735 Ga0123357_100337352 195
116 3300010167 Ga0123353_10000467 Ga0123353_100004677 195
117 3300042590 Ga0466690_324640 Ga0466690_324640_2846_3433 195
118 3300042612 Ga0466705_426510 Ga0466705_426510_10132_10719 195
119 3300042616 Ga0466715_602591 Ga0466715_602591_10042_10629 195
120 3300042618 Ga0466723_350099 Ga0466723_350099_9701_10288 195
121 3300042618 Ga0466723_351486 Ga0466723_351486_459_1046 195
122 3300042619 Ga0466726_383206 Ga0466726_383206_2217_2804 195
123 3300042643 Ga0466704_448201 Ga0466704_448201_3111_3698 195
124 3300042643 Ga0466704_551659 Ga0466704_551659_445_1032 195
125 3300042599 Ga0466706_166478 Ga0466706_166478_48882_49472 196
126 3300042599 Ga0466706_217033 Ga0466706_217033_78120_78713 197
127 3300042592 Ga0466693_222853 Ga0466693_222853_265_861 198
128 3300042613 Ga0466710_048869 Ga0466710_048869_445_1041 198
129 3300042614 Ga0466712_236422 Ga0466712_236422_597_1193 198
130 3300042617 Ga0466718_057353 Ga0466718_057353_11426_12022 198
131 3300005201 Ga0072941_1146420 Ga0072941_11464201 199
132 3300042624 Ga0466735_013899 Ga0466735_013899_256_855 199
133 3300042636 Ga0466703_003589 Ga0466703_003589_599_1198 199
134 3300042624 Ga0466735_071145 Ga0466735_071145_3390_3998 202
135 3300042621 Ga0466729_016394 Ga0466729_016394_348_959 203
136 3300042590 Ga0466690_309270 Ga0466690_309270_23900_24514 204
137 3300042616 Ga0466715_006925 Ga0466715_006925_17695_18309 204
138 3300042616 Ga0466715_103093 Ga0466715_103093_3655_4272 205
139 3300042616 Ga0466715_289200 Ga0466715_289200_2343_2972 209
140 3300042618 Ga0466723_061356 Ga0466723_061356_263_892 209
141 3300042619 Ga0466726_217236 Ga0466726_217236_59453_60091 212

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01558 POR Pyruvate ferredoxin/flavodoxin oxidoreductase 33 206 0.94

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01558 GO:0016903 oxidoreductase activity, acting on the aldehyde or oxo group of donors MF

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
2raa-assembly1.cif.gz_A Crystal structure of pyruvate oxidoreductase subunit PORC (EC 1.2.7.1) (TM0015) from Thermotoga maritima at 2.12 A resolution 0.915 23 210
5exd-assembly1.cif.gz_B Crystal structure of oxalate oxidoreductase from Moorella thermoacetica bound with carboxy-di-oxido-methyl-TPP (COOM-TPP) intermediate 0.863 24 210
6ciq-assembly2.cif.gz_C Pyruvate:ferredoxin oxidoreductase from Moorella thermoacetica with coenzyme A bound 0.852 24 210
6cio-assembly3.cif.gz_F Pyruvate:ferredoxin oxidoreductase from Moorella thermoacetica with lactyl-TPP bound 0.85 24 210
5exe-assembly1.cif.gz_E Crystal structure of oxalate oxidoreductase from Moorella thermoacetica bound with carboxy-TPP adduct 0.848 18 210
IDDescriptionScoreStartEndSuperfamily
af_Q57717_1_177_3.40.920.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.9339 25 207 3.40.920.10
2raaA00 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.9148 23 210 3.40.920.10
af_P52647_417_621_3.40.920.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8813 25 210 3.40.920.10
1kekB03 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8462 23 210 3.40.920.10
af_Q2FZ05_1_182_3.40.920.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate-ferredoxin Oxidoreductase; domain 3;Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.8168 24 208 3.40.920.10
IDDescriptionScoreStartEndGO Terms
AF-T1C9X2-F1-model_v4 Pyruvate/ketoisovalerate oxidoreductase catalytic domain-containing protein 0.9772 25 119 GO:0016625

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.