Protein Family IF08256

Metagenome Isolate
148 Members
46 Samples
142 Scaffolds
89.64 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_192721|Ga0466726_192721_690_1022
Length
110 aa
Sequence
MEAFNMNVKMSNFGDILLSRPAGREAFLMARAYVFKGIQPVEDIILDFSDIKVLAPSWIDEFITGIKSGYSNKLACLNTENPSVAASLKTVLAPRPQVLTSFKVIISSSL

📊 Sample Types

Isolate 4.0%
Metagenome 96.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 48.9%
Kalotermitidae 22.2%
Unclassified 15.6%
Termopsidae 8.9%
Rhinotermitidae 4.4%

🌳 Taxonomy

Archaea 0
Bacteria 140
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
2 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
5 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
6 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
9 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
10 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
11 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
12 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
13 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
14 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
15 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
16 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
17 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
18 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
19 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
20 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
21 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
22 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
23 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
24 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
25 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
26 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
27 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
28 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
29 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
30 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
31 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
32 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
33 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
34 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
35 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
36 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
37 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
38 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
39 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
40 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
41 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
42 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
43 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
44 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
45 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
46 650716102 Treponema primitia ZAS-2 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_023989 3300042659 Bacteria 3809
2 Ga0466712_272877 3300042614 Bacteria 4143
3 Ga0466729_179836 3300042621 Bacteria 1054
4 Ga0123356_12649747 3300010049 Bacteria 628
5 Ga0123353_10919233 3300010167 Bacteria 1188
6 Ga0466727_213875 3300042655 Bacteria 1248
7 Ga0466727_337899 3300042655 Bacteria 1254
8 Ga0466707_062045 3300042601 Bacteria 1069
9 Ga0466716_053459 3300042605 Bacteria 5839
10 Ga0466719_132955 3300042606 Bacteria 1860
11 JGI24695J34938_10159251 3300002450 Bacteria 927
12 Ga0068302_10187940 3300005071 Bacteria 990
13 Ga0466728_163582 3300042620 Bacteria 2628
14 Ga0123353_11365269 3300010167 Bacteria 914
15 Ga0123353_11659394 3300010167 Bacteria 803
16 Ga0123353_11772910 3300010167 Bacteria 769
17 Ga0466702_330158 3300042635 Bacteria 13833
18 Ga0466704_284210 3300042643 Bacteria 2245
19 Ga0466707_354808 3300042601 Bacteria 1072
20 Ga0466694_385670 3300042594 Bacteria 1275
21 Ga0466699_050864 3300042597 Bacteria 1076
22 Ga0466699_182313 3300042597 Bacteria 3086
23 Ga0466699_431885 3300042597 Bacteria 1169
24 Ga0068305_10530025 3300005083 Bacteria 9937
25 Ga0072941_1001794 3300005201 Bacteria 25495
26 Ga0466723_052655 3300042618 Bacteria 4529
27 Ga0123356_11394147 3300010049 Bacteria 861
28 Ga0123353_11428572 3300010167 Bacteria 887
29 Ga0466702_400920 3300042635 Bacteria 1470
30 Ga0466727_138728 3300042655 Bacteria 1049
31 Ga0466727_296807 3300042655 Bacteria 1370
32 Ga0466707_121368 3300042601 Bacteria 1431
33 Ga0466719_532831 3300042606 Unclassified 1060
34 Ga0466656_252015 3300042550 Bacteria 1407
35 Ga0466699_061551 3300042597 Bacteria 3991
36 Ga0466699_068722 3300042597 Bacteria 2026
37 Ga0466699_097544 3300042597 Bacteria 2833
38 Ga0466699_374590 3300042597 Unclassified 2164
39 JGI24695J34938_10037549 3300002450 Bacteria 2200
40 Ga0072941_1006873 3300005201 Bacteria 20704
41 Ga0466726_447647 3300042619 Bacteria 1094
42 Ga0466734_148147 3300042623 Bacteria 1363
43 Ga0466703_209752 3300042636 Bacteria 1236
44 Ga0466704_579289 3300042643 Bacteria 2568
45 Ga0466727_255569 3300042655 Bacteria 8054
46 Ga0466700_299022 3300042600 Bacteria 1098
47 Ga0466720_030037 3300042607 Bacteria 1468
48 Ga0466690_148995 3300042590 Bacteria 1809
49 Ga0466695_141338 3300042595 Bacteria 4553
50 Ga0466699_354451 3300042597 Bacteria 3332
51 AustNasuHG_c1004172 3300000089 Bacteria 5193
52 AustNasuHG_c1030357 3300000089 Bacteria 1557
53 AustNasuHG_c1030611 3300000089 Bacteria 1545
54 JGI24702J35022_10002358 3300002462 Bacteria 11552
55 JGI24702J35022_10066666 3300002462 Bacteria 1932
56 Ga0072941_1046244 3300005201 Bacteria 4886
57 Ga0072941_1087614 3300005201 Unclassified 1263
58 Ga0466705_215394 3300042612 Bacteria 1243
59 Ga0466712_031052 3300042614 Bacteria 1390
60 Ga0466726_279178 3300042619 Bacteria 1376
61 Ga0466726_312563 3300042619 Bacteria 1848
62 Ga0123356_10045262 3300010049 Bacteria 4095
63 Ga0123356_12346966 3300010049 Bacteria 667
64 Ga0123353_12527573 3300010167 Bacteria 610
65 Ga0466735_199674 3300042624 Bacteria 1543
66 Ga0466702_204915 3300042635 Bacteria 1096
67 Ga0466703_210110 3300042636 Bacteria 87073
68 Ga0466704_124285 3300042643 Bacteria 2414
69 Ga0466727_142246 3300042655 Bacteria 4021
70 Ga0466717_292783 3300042604 Bacteria 1097
71 Ga0466691_005178 3300042593 Bacteria 2216
72 Ga0466694_012452 3300042594 Bacteria 3719
73 Ga0466694_030381 3300042594 Bacteria 1315
74 Ga0466694_254620 3300042594 Bacteria 1459
75 Ga0466699_066378 3300042597 Bacteria 1111
76 Ga0072941_1036658 3300005201 Bacteria 2451
77 Ga0466711_374414 3300042615 Bacteria 4543
78 Ga0466726_063337 3300042619 Bacteria 8853
79 Ga0123356_11022242 3300010049 Bacteria 996
80 Ga0466729_205642 3300042621 Unclassified 1488
81 Ga0466735_091383 3300042624 Bacteria 1185
82 Ga0466707_043607 3300042601 Bacteria 1212
83 Ga0466707_177860 3300042601 Bacteria 1297
84 Ga0466698_226069 3300042610 Bacteria 2346
85 Ga0466690_296428 3300042590 Bacteria 2577
86 Ga0466694_070366 3300042594 Bacteria 1483
87 Ga0466695_391011 3300042595 Bacteria 1270
88 Ga0466699_045947 3300042597 Bacteria 18961
89 Ga0466699_159650 3300042597 Bacteria 5388
90 Ga0466699_290165 3300042597 Bacteria 2761
91 JGI24695J34938_10006696 3300002450 Bacteria 6864
92 JGI24695J34938_10164766 3300002450 Bacteria 912
93 JGI24695J34938_10464488 3300002450 Bacteria 574
94 Ga0072941_1002036 3300005201 Bacteria 1374
95 Ga0466705_062791 3300042612 Bacteria 1352
96 Ga0466718_078627 3300042617 Bacteria 5896
97 Ga0466718_135735 3300042617 Bacteria 1690
98 Ga0466718_142539 3300042617 Bacteria 1191
99 Ga0466726_192721 3300042619 Bacteria 1211
100 Ga0466726_407983 3300042619 Bacteria 1649
101 Ga0466726_455637 3300042619 Bacteria 2329
102 Ga0123356_10002253 3300010049 Bacteria 20803
103 Ga0123356_10381055 3300010049 Bacteria 1543
104 Ga0466735_100405 3300042624 Bacteria 2600
105 Ga0466703_225557 3300042636 Unclassified 1066
106 Ga0466707_026713 3300042601 Bacteria 2520
107 Ga0466707_235155 3300042601 Bacteria 1455
108 Ga0466707_313296 3300042601 Bacteria 1590
109 Ga0466720_113496 3300042607 Bacteria 1362
110 Ga0466698_385597 3300042610 Bacteria 1228
111 Ga0466699_064563 3300042597 Bacteria 1095
112 Ga0466699_071522 3300042597 Bacteria 1440
113 Ga0466699_129225 3300042597 Unclassified 1017
114 Ga0466699_241240 3300042597 Bacteria 1228
115 Ga0466699_338698 3300042597 Bacteria 62334
116 AustNasuHG_c1004826 3300000089 Bacteria 4828
117 AustNasuHG_c1009489 3300000089 Bacteria 3415
118 JGI24698J34947_10026507 3300002449 Bacteria 3079
119 JGI24695J34938_10084036 3300002450 Bacteria 1312
120 JGI24702J35022_10078071 3300002462 Bacteria 1791
121 JGI24705J35276_12177303 3300002504 Bacteria 1338
122 Ga0074263_135800 3300005485 Bacteria 867
123 Ga0466718_127755 3300042617 Bacteria 5201
124 Ga0466726_213552 3300042619 Bacteria 19773
125 Ga0466726_310026 3300042619 Bacteria 1106
126 Ga0466726_371740 3300042619 Bacteria 1476
127 Ga0123357_10390634 3300009784 Bacteria 1279
128 Ga0123356_11144240 3300010049 Unclassified 946
129 Ga0123356_12257202 3300010049 Bacteria 680
130 Ga0123353_11076285 3300010167 Bacteria 1071
131 Ga0123353_11388488 3300010167 Bacteria 904
132 Ga0466703_017118 3300042636 Bacteria 15056
133 Ga0466727_306007 3300042655 Bacteria 1342
134 Ga0466707_138136 3300042601 Bacteria 1831
135 Ga0466722_077641 3300042609 Bacteria 1898
136 Ga0466698_409754 3300042610 Bacteria 1292
137 Ga0466694_237948 3300042594 Bacteria 1356
138 Ga0466699_207627 3300042597 Unclassified 1154
139 JGI24702J35022_10077214 3300002462 Bacteria 1801
140 Ga0072941_1067376 3300005201 Bacteria 2100
141 Ga0072941_1286190 3300005201 Bacteria 576
142 Ga0072941_1331838 3300005201 Bacteria 763

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2781125644 2781295422 87
2 3300002450 JGI24695J34938_10084036 JGI24695J34938_100840362 88
3 3300002450 JGI24695J34938_10159251 JGI24695J34938_101592512 88
4 3300002450 JGI24695J34938_10164766 JGI24695J34938_101647662 88
5 3300002450 JGI24695J34938_10464488 JGI24695J34938_104644881 88
6 3300010049 Ga0123356_10045262 Ga0123356_100452623 88
7 3300010049 Ga0123356_11144240 Ga0123356_111442403 88
8 3300010167 Ga0123353_10919233 Ga0123353_109192332 88
9 3300010167 Ga0123353_11076285 Ga0123353_110762852 88
10 3300010167 Ga0123353_11365269 Ga0123353_113652691 88
11 3300010167 Ga0123353_11659394 Ga0123353_116593942 88
12 3300010167 Ga0123353_11772910 Ga0123353_117729102 88
13 3300042590 Ga0466690_148995 Ga0466690_148995_1417_1683 88
14 3300042590 Ga0466690_296428 Ga0466690_296428_385_651 88
15 3300042593 Ga0466691_005178 Ga0466691_005178_1236_1502 88
16 3300042595 Ga0466695_391011 Ga0466695_391011_448_714 88
17 3300042597 Ga0466699_045947 Ga0466699_045947_1967_2233 88
18 3300042597 Ga0466699_068722 Ga0466699_068722_1389_1655 88
19 3300042597 Ga0466699_431885 Ga0466699_431885_818_1084 88
20 3300042601 Ga0466707_062045 Ga0466707_062045_720_986 88
21 3300042601 Ga0466707_177860 Ga0466707_177860_941_1207 88
22 3300042604 Ga0466717_292783 Ga0466717_292783_379_645 88
23 3300042605 Ga0466716_053459 Ga0466716_053459_5460_5726 88
24 3300042606 Ga0466719_132955 Ga0466719_132955_1265_1531 88
25 3300042606 Ga0466719_532831 Ga0466719_532831_747_1013 88
26 3300042607 Ga0466720_030037 Ga0466720_030037_1084_1350 88
27 3300042607 Ga0466720_113496 Ga0466720_113496_783_1049 88
28 3300042612 Ga0466705_062791 Ga0466705_062791_1000_1266 88
29 3300042612 Ga0466705_215394 Ga0466705_215394_304_570 88
30 3300042614 Ga0466712_272877 Ga0466712_272877_1299_1565 88
31 3300042617 Ga0466718_135735 Ga0466718_135735_85_351 88
32 3300042617 Ga0466718_142539 Ga0466718_142539_886_1152 88
33 3300042618 Ga0466723_052655 Ga0466723_052655_4102_4368 88
34 3300042619 Ga0466726_213552 Ga0466726_213552_449_715 88
35 3300042619 Ga0466726_371740 Ga0466726_371740_292_558 88
36 3300042624 Ga0466735_091383 Ga0466735_091383_888_1154 88
37 3300042635 Ga0466702_204915 Ga0466702_204915_772_1038 88
38 3300042636 Ga0466703_017118 Ga0466703_017118_14325_14591 88
39 3300042636 Ga0466703_209752 Ga0466703_209752_21_287 88
40 3300042636 Ga0466703_210110 Ga0466703_210110_59865_60131 88
41 3300042636 Ga0466703_225557 Ga0466703_225557_429_695 88
42 3300042643 Ga0466704_124285 Ga0466704_124285_18_284 88
43 3300042643 Ga0466704_284210 Ga0466704_284210_1390_1656 88
44 3300042643 Ga0466704_579289 Ga0466704_579289_536_802 88
45 3300042655 Ga0466727_138728 Ga0466727_138728_682_948 88
46 3300042655 Ga0466727_142246 Ga0466727_142246_1090_1356 88
47 3300042655 Ga0466727_306007 Ga0466727_306007_686_952 88
48 3300042655 Ga0466727_337899 Ga0466727_337899_202_468 88
49 iso_pr_bacteria 2781125662 2781337204 88
50 iso_pr_bacteria 650716099 650877826 88
51 iso_pr_bacteria 650716102 650882595 88
52 3300000089 AustNasuHG_c1009489 AustNasuHG_10094892 89
53 3300000089 AustNasuHG_c1030357 AustNasuHG_10303572 89
54 3300000089 AustNasuHG_c1030611 AustNasuHG_10306113 89
55 3300002449 JGI24698J34947_10026507 JGI24698J34947_100265074 89
56 3300002462 JGI24702J35022_10002358 JGI24702J35022_100023587 89
57 3300002462 JGI24702J35022_10066666 JGI24702J35022_100666663 89
58 3300002462 JGI24702J35022_10077214 JGI24702J35022_100772141 89
59 3300002462 JGI24702J35022_10078071 JGI24702J35022_100780711 89
60 3300005201 Ga0072941_1001794 Ga0072941_10017944 89
61 3300005201 Ga0072941_1002036 Ga0072941_10020361 89
62 3300005201 Ga0072941_1006873 Ga0072941_100687312 89
63 3300005201 Ga0072941_1036658 Ga0072941_10366583 89
64 3300005201 Ga0072941_1046244 Ga0072941_10462442 89
65 3300005201 Ga0072941_1067376 Ga0072941_10673761 89
66 3300005201 Ga0072941_1087614 Ga0072941_10876142 89
67 3300005201 Ga0072941_1286190 Ga0072941_12861902 89
68 3300005201 Ga0072941_1331838 Ga0072941_13318381 89
69 3300010049 Ga0123356_10002253 Ga0123356_100022534 89
70 3300010049 Ga0123356_11022242 Ga0123356_110222422 89
71 3300010049 Ga0123356_11394147 Ga0123356_113941472 89
72 3300010049 Ga0123356_12346966 Ga0123356_123469661 89
73 3300010049 Ga0123356_12649747 Ga0123356_126497472 89
74 3300010167 Ga0123353_11388488 Ga0123353_113884882 89
75 3300010167 Ga0123353_11428572 Ga0123353_114285723 89
76 3300010167 Ga0123353_12527573 Ga0123353_125275732 89
77 3300042594 Ga0466694_012452 Ga0466694_012452_3404_3673 89
78 3300042594 Ga0466694_030381 Ga0466694_030381_686_955 89
79 3300042594 Ga0466694_070366 Ga0466694_070366_158_427 89
80 3300042594 Ga0466694_237948 Ga0466694_237948_538_807 89
81 3300042594 Ga0466694_254620 Ga0466694_254620_203_472 89
82 3300042595 Ga0466695_141338 Ga0466695_141338_3558_3827 89
83 3300042600 Ga0466700_299022 Ga0466700_299022_274_543 89
84 3300042601 Ga0466707_026713 Ga0466707_026713_1926_2195 89
85 3300042601 Ga0466707_043607 Ga0466707_043607_292_561 89
86 3300042601 Ga0466707_121368 Ga0466707_121368_1017_1286 89
87 3300042601 Ga0466707_138136 Ga0466707_138136_202_471 89
88 3300042601 Ga0466707_235155 Ga0466707_235155_404_673 89
89 3300042601 Ga0466707_313296 Ga0466707_313296_1157_1426 89
90 3300042601 Ga0466707_354808 Ga0466707_354808_586_855 89
91 3300042609 Ga0466722_077641 Ga0466722_077641_994_1263 89
92 3300042610 Ga0466698_226069 Ga0466698_226069_1080_1349 89
93 3300042610 Ga0466698_385597 Ga0466698_385597_830_1099 89
94 3300042610 Ga0466698_409754 Ga0466698_409754_544_813 89
95 3300042615 Ga0466711_374414 Ga0466711_374414_3057_3326 89
96 3300042619 Ga0466726_279178 Ga0466726_279178_1022_1291 89
97 3300042619 Ga0466726_447647 Ga0466726_447647_90_359 89
98 3300042621 Ga0466729_179836 Ga0466729_179836_598_867 89
99 3300042621 Ga0466729_205642 Ga0466729_205642_43_312 89
100 3300042624 Ga0466735_100405 Ga0466735_100405_1504_1773 89
101 3300042635 Ga0466702_400920 Ga0466702_400920_401_670 89
102 3300042655 Ga0466727_296807 Ga0466727_296807_1066_1335 89
103 iso_pr_bacteria 650716102 650882848 89
104 3300000089 AustNasuHG_c1004172 AustNasuHG_10041723 90
105 3300000089 AustNasuHG_c1004826 AustNasuHG_10048261 90
106 3300002450 JGI24695J34938_10037549 JGI24695J34938_100375492 90
107 3300002504 JGI24705J35276_12177303 JGI24705J35276_121773033 90
108 3300005071 Ga0068302_10187940 Ga0068302_101879401 90
109 3300005485 Ga0074263_135800 Ga0074263_1358001 90
110 3300009784 Ga0123357_10390634 Ga0123357_103906342 90
111 3300010049 Ga0123356_12257202 Ga0123356_122572022 90
112 3300042597 Ga0466699_129225 Ga0466699_129225_719_991 90
113 3300042597 Ga0466699_182313 Ga0466699_182313_507_779 90
114 3300042597 Ga0466699_207627 Ga0466699_207627_419_691 90
115 3300042597 Ga0466699_338698 Ga0466699_338698_47848_48120 90
116 3300042617 Ga0466718_127755 Ga0466718_127755_298_570 90
117 3300042619 Ga0466726_310026 Ga0466726_310026_715_987 90
118 3300042619 Ga0466726_407983 Ga0466726_407983_745_1017 90
119 3300042619 Ga0466726_455637 Ga0466726_455637_892_1164 90
120 3300042620 Ga0466728_163582 Ga0466728_163582_365_637 90
121 3300042624 Ga0466735_199674 Ga0466735_199674_1002_1274 90
122 3300042635 Ga0466702_330158 Ga0466702_330158_10498_10770 90
123 3300042655 Ga0466727_255569 Ga0466727_255569_707_979 90
124 3300005083 Ga0068305_10530025 Ga0068305_105300254 91
125 3300042597 Ga0466699_064563 Ga0466699_064563_502_777 91
126 3300042597 Ga0466699_071522 Ga0466699_071522_771_1046 91
127 3300042597 Ga0466699_290165 Ga0466699_290165_960_1235 91
128 3300042597 Ga0466699_241240 Ga0466699_241240_847_1125 92
129 3300042614 Ga0466712_031052 Ga0466712_031052_560_838 92
130 3300042617 Ga0466718_078627 Ga0466718_078627_4244_4522 92
131 3300042659 Ga0466733_023989 Ga0466733_023989_597_875 92
132 iso_pr_bacteria 2781125697 2781443394 92
133 3300042594 Ga0466694_385670 Ga0466694_385670_259_540 93
134 3300042597 Ga0466699_050864 Ga0466699_050864_120_401 93
135 3300042619 Ga0466726_063337 Ga0466726_063337_5865_6146 93
136 3300042623 Ga0466734_148147 Ga0466734_148147_710_991 93
137 3300042655 Ga0466727_213875 Ga0466727_213875_325_606 93
138 3300010049 Ga0123356_10381055 Ga0123356_103810551 94
139 3300042550 Ga0466656_252015 Ga0466656_252015_960_1244 94
140 3300042597 Ga0466699_061551 Ga0466699_061551_2720_3004 94
141 3300042597 Ga0466699_159650 Ga0466699_159650_2149_2433 94
142 3300042597 Ga0466699_374590 Ga0466699_374590_307_591 94
143 3300042619 Ga0466726_312563 Ga0466726_312563_773_1057 94
144 3300042597 Ga0466699_066378 Ga0466699_066378_444_731 95
145 3300042597 Ga0466699_097544 Ga0466699_097544_1254_1541 95
146 3300042597 Ga0466699_354451 Ga0466699_354451_1665_1952 95
147 3300002450 JGI24695J34938_10006696 JGI24695J34938_100066966 103
148 3300042619 Ga0466726_192721 Ga0466726_192721_690_1022 110

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF14213 DUF4325 STAS-like domain of unknown function (DUF4325) 33 78 0.82

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.