Protein Family IF08250

Metagenome Isolate
111 Members
51 Samples
103 Scaffolds
165.15 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_170872|Ga0466726_170872_448_1047
Length
199 aa
Sequence
MKINPEVKSIFDFRYEDFELMGYDPHPHITGIVAVENRKISIIVVTGKDNELGKGNDLLCRLPVDLKRFKEITSGHTVIMGRKTFESLPKGPLPNRRNIVISRNKDLTIEGAEVYPSLDYTLVKLIDETEVFIIGGAQIYEQSLPVADKLYLTRIHAGFPEADAFFPGINFHEWRETNRETFPADEKNPYSFTFFEYER

📊 Sample Types

Isolate 7.2%
Metagenome 92.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 30.0%
Kalotermitidae 26.0%
Unclassified 14.0%
Culicidae 6.0%
Rhinotermitidae 6.0%
Termopsidae 6.0%
Passalidae 4.0%
Hydrophilidae 2.0%
Daphniidae 2.0%
Hodotermitidae 2.0%
Blattidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 106
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
2 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
7 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
8 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
9 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
10 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
11 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
12 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
13 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
14 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
15 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
16 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
19 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
20 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
21 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
22 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
23 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
26 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
27 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
28 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
29 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
30 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
31 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
32 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
33 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
34 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
40 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
41 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
42 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
43 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
44 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
45 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
46 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
47 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
48 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
49 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
50 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
51 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466690_120697 3300042590 Bacteria 21927
2 Ga0123353_10047490 3300010167 Bacteria 6829
3 Ga0466706_048730 3300042599 Bacteria 101759
4 Ga0466707_015156 3300042601 Bacteria 10188
5 Ga0466707_396449 3300042601 Bacteria 5028
6 Ga0466714_055457 3300042603 Bacteria 2101
7 Ga0466711_499171 3300042615 Bacteria 5429
8 Ga0466709_263562 3300042648 Bacteria 2651
9 Ga0466697_270125 3300042611 Bacteria 1278
10 Ga0466733_002151 3300042659 Bacteria 71476
11 Ga0160472_100177 3300012839 Bacteria 85140
12 Ga0466692_203147 3300042591 Bacteria 3856
13 Ga0466691_070467 3300042593 Bacteria 27137
14 Ga0123353_10499597 3300010167 Bacteria 1773
15 Ga0466722_018404 3300042609 Bacteria 6648
16 IMNBL1DRAFT_c0000347 3300000062 Bacteria 39256
17 Ga0466711_147709 3300042615 Bacteria 38159
18 Ga0466726_206532 3300042619 Bacteria 14119
19 Ga0466726_417209 3300042619 Bacteria 1090
20 Ga0466729_197696 3300042621 Bacteria 3557
21 Ga0466729_295903 3300042621 Bacteria 4336
22 Ga0466703_065831 3300042636 Bacteria 7986
23 Ga0466709_053597 3300042648 Bacteria 31896
24 Ga0160441_100077 3300012825 Bacteria 120763
25 Ga0160447_100021 3300012849 Bacteria 253505
26 Ga0466690_056584 3300042590 Bacteria 13118
27 Ga0123357_10175914 3300009784 Bacteria 2516
28 Ga0466701_042842 3300042598 Bacteria 1039
29 Ga0466700_028423 3300042600 Bacteria 18281
30 Ga0466707_354879 3300042601 Bacteria 6135
31 Ga0466723_016526 3300042618 Bacteria 5311
32 Ga0466723_120006 3300042618 Bacteria 38480
33 Ga0466726_177008 3300042619 Bacteria 9005
34 Ga0466728_427276 3300042620 Bacteria 19492
35 Ga0466735_218287 3300042624 Bacteria 3932
36 Ga0466704_022122 3300042643 Bacteria 10644
37 Ga0160472_103500 3300012839 Bacteria 3080
38 Ga0123354_10056251 3300010882 Bacteria 5875
39 Ga0466700_111158 3300042600 Bacteria 6636
40 Ga0466713_059017 3300042602 Bacteria 26100
41 Ga0466719_374892 3300042606 Bacteria 3055
42 Ga0466722_049386 3300042609 Bacteria 2829
43 JGI24705J35276_12219232 3300002504 Bacteria 2193
44 Ga0466710_204428 3300042613 Bacteria 1133
45 Ga0466715_413383 3300042616 Bacteria 2838
46 Ga0466726_147809 3300042619 Bacteria 13302
47 Ga0466735_002146 3300042624 Bacteria 1218
48 Ga0466703_242695 3300042636 Bacteria 4576
49 Ga0466704_164090 3300042643 Bacteria 2433
50 Ga0466708_324196 3300042652 Bacteria 22948
51 Ga0466727_341714 3300042655 Bacteria 3581
52 Ga0466733_211262 3300042659 Bacteria 17148
53 Ga0466693_444956 3300042592 Bacteria 1112
54 Ga0466691_171449 3300042593 Bacteria 1483
55 Ga0466696_124849 3300042596 Bacteria 6191
56 Ga0466696_387672 3300042596 Bacteria 1755
57 Ga0466707_069124 3300042601 Bacteria 8715
58 Ga0466707_272109 3300042601 Bacteria 19065
59 Ga0466722_267905 3300042609 Bacteria 4608
60 Ga0466715_011037 3300042616 Bacteria 18221
61 Ga0466726_170872 3300042619 Bacteria 1068
62 Ga0466728_104925 3300042620 Bacteria 1634
63 Ga0466735_057872 3300042624 Bacteria 3778
64 Ga0466735_235494 3300042624 Bacteria 6847
65 Ga0466703_090332 3300042636 Bacteria 4334
66 Ga0466704_242414 3300042643 Bacteria 10846
67 Ga0466727_036749 3300042655 Bacteria 8059
68 Ga0466695_386632 3300042595 Bacteria 3495
69 Ga0123353_10220306 3300010167 Bacteria 2967
70 Ga0466701_088409 3300042598 Bacteria 49099
71 Ga0466707_122422 3300042601 Bacteria 17295
72 Ga0466707_245212 3300042601 Bacteria 8812
73 Ga0466719_208701 3300042606 Bacteria 12122
74 Ga0466719_351263 3300042606 Bacteria 20574
75 Ga0466729_252286 3300042621 Bacteria 4153
76 Ga0466735_138859 3300042624 Bacteria 3235
77 Ga0466735_192167 3300042624 Unclassified 1157
78 Ga0466702_283325 3300042635 Bacteria 1402
79 Ga0466708_052338 3300042652 Bacteria 19084
80 Ga0160446_100006 3300012835 Bacteria 445354
81 Ga0466691_039736 3300042593 Bacteria 4327
82 Ga0466694_338309 3300042594 Bacteria 2242
83 Ga0123357_10005406 3300009784 Bacteria 15290
84 Ga0123353_10056366 3300010167 Bacteria 6289
85 Ga0466700_036908 3300042600 Bacteria 19911
86 Ga0466707_193518 3300042601 Unclassified 1002
87 Ga0466707_336346 3300042601 Bacteria 8440
88 2227671835 2225789004 Bacteria 10136
89 IMNBL1DRAFT_c0002536 3300000062 Bacteria 12623
90 JGI24702J35022_10002259 3300002462 Bacteria 11829
91 Ga0466726_216815 3300042619 Unclassified 1050
92 Ga0466727_129059 3300042655 Unclassified 2417
93 Ga0466705_054544 3300042612 Bacteria 4050
94 Ga0123353_10675222 3300010167 Unclassified 1456
95 Ga0123354_10150983 3300010882 Bacteria 2815
96 Ga0466700_294624 3300042600 Bacteria 3440
97 JGI24702J35022_10000077 3300002462 Bacteria 43640
98 Ga0466715_037844 3300042616 Bacteria 4474
99 Ga0466728_419283 3300042620 Bacteria 1166
100 Ga0466735_167776 3300042624 Bacteria 16226
101 Ga0466703_171481 3300042636 Bacteria 8911
102 Ga0466727_139013 3300042655 Bacteria 9460
103 Ga0466727_158449 3300042655 Bacteria 1344

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042620 Ga0466728_104925 Ga0466728_104925_684_1163 159
2 3300042652 Ga0466708_052338 Ga0466708_052338_2509_2988 159
3 3300042618 Ga0466723_120006 Ga0466723_120006_14501_14983 160
4 3300042652 Ga0466708_324196 Ga0466708_324196_13833_14315 160
5 3300042599 Ga0466706_048730 Ga0466706_048730_38596_39081 161
6 iso_pr_bacteria 2820736622 2820736682 161
7 iso_pr_bacteria 2820740053 2820740129 161
8 3300002462 JGI24702J35022_10000077 JGI24702J35022_1000007712 162
9 3300010167 Ga0123353_10220306 Ga0123353_102203063 162
10 3300042593 Ga0466691_171449 Ga0466691_171449_567_1055 162
11 3300042596 Ga0466696_124849 Ga0466696_124849_2073_2561 162
12 3300042600 Ga0466700_028423 Ga0466700_028423_3227_3715 162
13 3300042600 Ga0466700_036908 Ga0466700_036908_18753_19241 162
14 3300042601 Ga0466707_193518 Ga0466707_193518_144_632 162
15 3300042601 Ga0466707_245212 Ga0466707_245212_2274_2762 162
16 3300042602 Ga0466713_059017 Ga0466713_059017_5768_6256 162
17 3300042609 Ga0466722_049386 Ga0466722_049386_143_631 162
18 3300042609 Ga0466722_267905 Ga0466722_267905_1792_2280 162
19 3300042615 Ga0466711_147709 Ga0466711_147709_30843_31331 162
20 3300042616 Ga0466715_037844 Ga0466715_037844_661_1149 162
21 3300042618 Ga0466723_016526 Ga0466723_016526_1873_2361 162
22 3300042619 Ga0466726_417209 Ga0466726_417209_143_631 162
23 3300042621 Ga0466729_197696 Ga0466729_197696_2576_3064 162
24 3300042621 Ga0466729_252286 Ga0466729_252286_2603_3091 162
25 3300042621 Ga0466729_295903 Ga0466729_295903_2037_2525 162
26 3300042624 Ga0466735_235494 Ga0466735_235494_5293_5781 162
27 3300042643 Ga0466704_242414 Ga0466704_242414_8908_9396 162
28 3300042648 Ga0466709_053597 Ga0466709_053597_4300_4788 162
29 3300042648 Ga0466709_263562 Ga0466709_263562_279_767 162
30 3300042655 Ga0466727_129059 Ga0466727_129059_1045_1533 162
31 3300042655 Ga0466727_158449 Ga0466727_158449_795_1283 162
32 3300042655 Ga0466727_341714 Ga0466727_341714_25_513 162
33 iso_pr_bacteria 2967483437 2967487324 162
34 3300000062 IMNBL1DRAFT_c0000347 IMNBL1DRAFT_000034724 163
35 3300000062 IMNBL1DRAFT_c0002536 IMNBL1DRAFT_00025365 163
36 3300002462 JGI24702J35022_10002259 JGI24702J35022_100022599 163
37 3300010167 Ga0123353_10675222 Ga0123353_106752222 163
38 3300042590 Ga0466690_056584 Ga0466690_056584_4526_5017 163
39 3300042591 Ga0466692_203147 Ga0466692_203147_1228_1719 163
40 3300042592 Ga0466693_444956 Ga0466693_444956_140_631 163
41 3300042598 Ga0466701_088409 Ga0466701_088409_41342_41833 163
42 3300042601 Ga0466707_122422 Ga0466707_122422_254_745 163
43 3300042601 Ga0466707_336346 Ga0466707_336346_859_1350 163
44 3300042606 Ga0466719_208701 Ga0466719_208701_9768_10259 163
45 3300042606 Ga0466719_351263 Ga0466719_351263_16843_17334 163
46 3300042606 Ga0466719_374892 Ga0466719_374892_783_1274 163
47 3300042611 Ga0466697_270125 Ga0466697_270125_167_658 163
48 3300042613 Ga0466710_204428 Ga0466710_204428_150_641 163
49 3300042616 Ga0466715_011037 Ga0466715_011037_13825_14316 163
50 3300042616 Ga0466715_413383 Ga0466715_413383_1179_1670 163
51 3300042619 Ga0466726_147809 Ga0466726_147809_5193_5684 163
52 3300042619 Ga0466726_177008 Ga0466726_177008_7512_8003 163
53 3300042620 Ga0466728_419283 Ga0466728_419283_605_1096 163
54 3300042620 Ga0466728_427276 Ga0466728_427276_10371_10862 163
55 3300042624 Ga0466735_002146 Ga0466735_002146_332_823 163
56 3300042624 Ga0466735_138859 Ga0466735_138859_297_788 163
57 3300042624 Ga0466735_167776 Ga0466735_167776_15463_15954 163
58 3300042624 Ga0466735_192167 Ga0466735_192167_552_1043 163
59 3300042643 Ga0466704_022122 Ga0466704_022122_6192_6683 163
60 3300042655 Ga0466727_036749 Ga0466727_036749_5745_6236 163
61 iso_pr_bacteria 2873776654 2873777066 163
62 iso_pr_bacteria 2940216256 2940217542 163
63 3300009784 Ga0123357_10175914 Ga0123357_101759142 164
64 3300010882 Ga0123354_10150983 Ga0123354_101509832 164
65 3300042593 Ga0466691_070467 Ga0466691_070467_16050_16544 164
66 3300042594 Ga0466694_338309 Ga0466694_338309_28_582 164
67 3300042598 Ga0466701_042842 Ga0466701_042842_336_830 164
68 3300042600 Ga0466700_111158 Ga0466700_111158_2844_3338 164
69 3300042601 Ga0466707_015156 Ga0466707_015156_6132_6626 164
70 3300042601 Ga0466707_354879 Ga0466707_354879_686_1180 164
71 3300042601 Ga0466707_396449 Ga0466707_396449_2644_3138 164
72 3300042603 Ga0466714_055457 Ga0466714_055457_683_1177 164
73 3300042612 Ga0466705_054544 Ga0466705_054544_250_744 164
74 3300042624 Ga0466735_057872 Ga0466735_057872_99_593 164
75 3300042635 Ga0466702_283325 Ga0466702_283325_180_674 164
76 3300042636 Ga0466703_171481 Ga0466703_171481_7297_7791 164
77 3300010167 Ga0123353_10499597 Ga0123353_104995972 165
78 3300042615 Ga0466711_499171 Ga0466711_499171_4020_4517 165
79 3300042659 Ga0466733_002151 Ga0466733_002151_11510_12007 165
80 iso_pr_bacteria 2820750388 2820751063 165
81 2225789004 2227671835 2228277625 166
82 3300002504 JGI24705J35276_12219232 JGI24705J35276_122192321 166
83 3300010882 Ga0123354_10056251 Ga0123354_100562514 166
84 3300042600 Ga0466700_294624 Ga0466700_294624_1697_2197 166
85 3300042636 Ga0466703_065831 Ga0466703_065831_6114_6614 166
86 3300042636 Ga0466703_090332 Ga0466703_090332_1416_1916 166
87 3300042636 Ga0466703_242695 Ga0466703_242695_938_1438 166
88 3300042643 Ga0466704_164090 Ga0466704_164090_1651_2151 166
89 3300010167 Ga0123353_10047490 Ga0123353_100474905 167
90 3300042595 Ga0466695_386632 Ga0466695_386632_1445_1948 167
91 3300042659 Ga0466733_211262 Ga0466733_211262_3794_4297 167
92 3300042593 Ga0466691_039736 Ga0466691_039736_3672_4178 168
93 3300042596 Ga0466696_387672 Ga0466696_387672_1204_1710 168
94 3300042601 Ga0466707_069124 Ga0466707_069124_3372_3878 168
95 3300042619 Ga0466726_206532 Ga0466726_206532_8148_8654 168
96 3300042624 Ga0466735_218287 Ga0466735_218287_2257_2763 168
97 3300042609 Ga0466722_018404 Ga0466722_018404_3198_3707 169
98 3300042655 Ga0466727_139013 Ga0466727_139013_4345_4854 169
99 3300012835 Ga0160446_100006 Ga0160446_100006162 170
100 3300012839 Ga0160472_100177 Ga0160472_1001771 170
101 3300012849 Ga0160447_100021 Ga0160447_100021161 170
102 3300042619 Ga0466726_216815 Ga0466726_216815_167_679 170
103 iso_pr_bacteria 2590828803 2592928154 170
104 3300042590 Ga0466690_120697 Ga0466690_120697_6373_6894 173
105 3300010167 Ga0123353_10056366 Ga0123353_100563662 175
106 iso_pr_bacteria 2820776227 2820777628 178
107 3300009784 Ga0123357_10005406 Ga0123357_100054068 179
108 3300012825 Ga0160441_100077 Ga0160441_10007748 181
109 3300012839 Ga0160472_103500 Ga0160472_1035003 185
110 3300042601 Ga0466707_272109 Ga0466707_272109_9052_9621 189
111 3300042619 Ga0466726_170872 Ga0466726_170872_448_1047 199

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00186 DHFR_1 Dihydrofolate reductase 39 199 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.