Protein Family IF08249
Metagenome
Isolate
207
Members
91
Samples
165
Scaffolds
309.59
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_168696|Ga0466726_168696_538_1662
- Length
- 374 aa
- Sequence
- MYLMEAYPYMLVIHENFTQIIHRSQGMVGYKYQKWILFILSVAMEIFLRRILLRKAYSLNTGNIVIISASRRTDVPAYYSDWLLNRIKERYVYVRNPMNIHQISKINLSPDVVDCIVFWSKNPKPMLDKLQFLNEYAYYFQFTLNPYDKDIEIRLPCKNEILEIFKKLSDIISPSKIIWRYDPVLLNKKYTISYHIDKFFEYAVKLKGYTEKVTFSFIDFYKKITENIKFAEMNEITYEEKNIIADNFSRIAKESNLLIDTCAEDIDLLKYNIAHARCIDDKLIAKIIGYNFFAEKDRNQRLECGCVGSIDIGEYNSCSNGCVYCYANYGQNVVKNNLKKHNKLLPLLIGEINEDDIINERKVVSNKILQKELL
Sample Types
Isolate
20.3%
Metagenome
79.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
33.0%
Termitidae
25.3%
Unclassified
18.7%
Kalotermitidae
14.3%
Termopsidae
3.3%
Rhinotermitidae
2.2%
Passalidae
2.2%
Hodotermitidae
1.1%
Taxonomy
Archaea
8
Bacteria
182
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2590828841 | Oscillospiraceae bacterium Ne3 | Isolate | Termitidae |
| 2 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 3 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 4 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 5 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 6 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 7 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 8 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 9 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 10 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 14 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 15 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 20 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 21 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 22 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 23 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 24 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 25 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 26 | 3300000473 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 | Metagenome | Apidae |
| 27 | 3300000490 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 | Metagenome | Apidae |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 31 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 32 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 33 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 34 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 35 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 36 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 37 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 38 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 39 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 40 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 41 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 42 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 43 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 44 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 45 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 46 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 47 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 48 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 49 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 50 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 51 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 52 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 53 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 54 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 55 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 56 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 57 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 58 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 59 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 60 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 61 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 62 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 63 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 64 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 65 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 66 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 67 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 68 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 69 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 70 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 71 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 72 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 73 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 74 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 75 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 76 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 77 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 78 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 79 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 80 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 81 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
| 82 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 83 | 2820013017 | Unclassified Spirochaetes Th196P3bin152 | Isolate | Unclassified |
| 84 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 85 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 86 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 87 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 88 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 89 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 90 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 91 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_026086 | 3300042659 | Bacteria | 2560 |
| 2 | Ga0466690_019169 | 3300042590 | Bacteria | 3240 |
| 3 | Ga0466692_110500 | 3300042591 | Bacteria | 1392 |
| 4 | Ga0466696_008317 | 3300042596 | Bacteria | 3084 |
| 5 | Ga0466706_078767 | 3300042599 | Bacteria | 2598 |
| 6 | Ga0466720_217205 | 3300042607 | Bacteria | 23129 |
| 7 | Ga0466735_039970 | 3300042624 | Bacteria | 3971 |
| 8 | Ga0466703_032402 | 3300042636 | Bacteria | 4434 |
| 9 | Ga0466704_235607 | 3300042643 | Bacteria | 13509 |
| 10 | Ga0466704_498154 | 3300042643 | Bacteria | 2919 |
| 11 | Ga0466727_051845 | 3300042655 | Bacteria | 3518 |
| 12 | Ga0466726_208889 | 3300042619 | Bacteria | 14929 |
| 13 | Ga0466726_433277 | 3300042619 | Bacteria | 1078 |
| 14 | SCG598I20_12783 | 3300000473 | Bacteria | 86326 |
| 15 | JGI24695J34938_10049260 | 3300002450 | Bacteria | 1852 |
| 16 | JGI24702J35022_10030488 | 3300002462 | Bacteria | 2894 |
| 17 | Ga0074263_115093 | 3300005485 | Bacteria | 5118 |
| 18 | Ga0466705_234594 | 3300042612 | Bacteria | 119076 |
| 19 | Ga0466692_089205 | 3300042591 | Unclassified | 1824 |
| 20 | Ga0466691_009031 | 3300042593 | Bacteria | 6698 |
| 21 | Ga0466691_205313 | 3300042593 | Bacteria | 3053 |
| 22 | Ga0466694_379747 | 3300042594 | Bacteria | 1006 |
| 23 | Ga0123353_10452310 | 3300010167 | Bacteria | 1890 |
| 24 | Ga0466713_070548 | 3300042602 | Bacteria | 6449 |
| 25 | Ga0466716_147864 | 3300042605 | Bacteria | 2655 |
| 26 | Ga0466698_308820 | 3300042610 | Bacteria | 1308 |
| 27 | Ga0466704_499584 | 3300042643 | Bacteria | 2688 |
| 28 | Ga0466705_471587 | 3300042612 | Unclassified | 11072 |
| 29 | Ga0466711_383833 | 3300042615 | Bacteria | 8870 |
| 30 | Ga0466711_433051 | 3300042615 | Bacteria | 6432 |
| 31 | Ga0466718_097932 | 3300042617 | Bacteria | 4881 |
| 32 | Ga0466723_133564 | 3300042618 | Bacteria | 1778 |
| 33 | Ga0466723_193754 | 3300042618 | Bacteria | 13053 |
| 34 | Ga0466726_168696 | 3300042619 | Bacteria | 2025 |
| 35 | JGI24698J34947_10003555 | 3300002449 | Bacteria | 8461 |
| 36 | Ga0466705_260038 | 3300042612 | Unclassified | 7427 |
| 37 | Ga0466705_340718 | 3300042612 | Bacteria | 1140 |
| 38 | Ga0466732_104607 | 3300042656 | Bacteria | 1596 |
| 39 | Ga0466732_351611 | 3300042656 | Bacteria | 2129 |
| 40 | Ga0466693_134287 | 3300042592 | Bacteria | 1247 |
| 41 | Ga0123355_10000891 | 3300009826 | Bacteria | 41353 |
| 42 | Ga0466706_029872 | 3300042599 | Bacteria | 7306 |
| 43 | Ga0466706_160411 | 3300042599 | Bacteria | 2819 |
| 44 | Ga0466706_197231 | 3300042599 | Bacteria | 1524 |
| 45 | Ga0466706_200351 | 3300042599 | Bacteria | 1300 |
| 46 | Ga0466714_038528 | 3300042603 | Bacteria | 3021 |
| 47 | Ga0466716_007115 | 3300042605 | Unclassified | 1243 |
| 48 | Ga0466720_079266 | 3300042607 | Bacteria | 13517 |
| 49 | Ga0466698_140163 | 3300042610 | Bacteria | 4337 |
| 50 | Ga0466735_164788 | 3300042624 | Bacteria | 1153 |
| 51 | Ga0466703_004670 | 3300042636 | Bacteria | 4798 |
| 52 | Ga0466709_084178 | 3300042648 | Bacteria | 96335 |
| 53 | Ga0466709_397457 | 3300042648 | Bacteria | 13705 |
| 54 | Ga0466708_102916 | 3300042652 | Bacteria | 2189 |
| 55 | Ga0466708_295739 | 3300042652 | Bacteria | 3660 |
| 56 | Ga0466705_445340 | 3300042612 | Bacteria | 14158 |
| 57 | Ga0466705_447940 | 3300042612 | Bacteria | 2598 |
| 58 | Ga0466711_283000 | 3300042615 | Bacteria | 27306 |
| 59 | Ga0466715_121188 | 3300042616 | Bacteria | 2336 |
| 60 | Ga0466718_162941 | 3300042617 | Bacteria | 1796 |
| 61 | Ga0466723_017694 | 3300042618 | Bacteria | 20517 |
| 62 | Ga0466728_022521 | 3300042620 | Bacteria | 2134 |
| 63 | JGI24695J34938_10007704 | 3300002450 | Bacteria | 6248 |
| 64 | Ga0466732_165573 | 3300042656 | Bacteria | 1634 |
| 65 | Ga0466692_177534 | 3300042591 | Bacteria | 2755 |
| 66 | Ga0466691_029356 | 3300042593 | Bacteria | 2139 |
| 67 | Ga0466707_012858 | 3300042601 | Bacteria | 8548 |
| 68 | Ga0466713_003122 | 3300042602 | Bacteria | 1306 |
| 69 | Ga0466720_030206 | 3300042607 | Bacteria | 1496 |
| 70 | Ga0466731_254336 | 3300042622 | Bacteria | 1974 |
| 71 | Ga0466735_034696 | 3300042624 | Unclassified | 1145 |
| 72 | Ga0466703_397811 | 3300042636 | Bacteria | 83754 |
| 73 | Ga0466711_150844 | 3300042615 | Bacteria | 1810 |
| 74 | Ga0466711_280934 | 3300042615 | Bacteria | 6127 |
| 75 | Ga0466718_000859 | 3300042617 | Bacteria | 3112 |
| 76 | Ga0466726_017517 | 3300042619 | Bacteria | 3424 |
| 77 | Ga0466726_208665 | 3300042619 | Bacteria | 1691 |
| 78 | Ga0466728_313732 | 3300042620 | Bacteria | 1224 |
| 79 | gam1t_NODE_619022_length=6948_GC=31_3_Contigs=4 | 2189573031 | Bacteria | 6978 |
| 80 | IMNBL1DRAFT_c0001841 | 3300000062 | Bacteria | 15454 |
| 81 | IMNBL1DRAFT_c0008153 | 3300000062 | Bacteria | 5384 |
| 82 | SCG598L16_115148 | 3300000490 | Unclassified | 8938 |
| 83 | JGI24698J34947_10043139 | 3300002449 | Bacteria | 2314 |
| 84 | JGI24695J34938_10013658 | 3300002450 | Bacteria | 4253 |
| 85 | JGI24695J34938_10027030 | 3300002450 | Bacteria | 2718 |
| 86 | JGI24699J35502_11133779 | 3300002509 | Bacteria | 15459 |
| 87 | Ga0074278_102689 | 3300005721 | Bacteria | 12077 |
| 88 | Ga0074278_116492 | 3300005721 | Unclassified | 6978 |
| 89 | Ga0415639_027425 | 3300038395 | Bacteria | 4823 |
| 90 | Ga0466694_011738 | 3300042594 | Bacteria | 3255 |
| 91 | Ga0466696_213173 | 3300042596 | Bacteria | 7451 |
| 92 | Ga0466696_375808 | 3300042596 | Bacteria | 2919 |
| 93 | Ga0123355_10001660 | 3300009826 | Bacteria | 30968 |
| 94 | Ga0123355_10356989 | 3300009826 | Bacteria | 1930 |
| 95 | Ga0123353_10366525 | 3300010167 | Bacteria | 2162 |
| 96 | Ga0466707_189775 | 3300042601 | Bacteria | 25069 |
| 97 | Ga0466713_065914 | 3300042602 | Bacteria | 9883 |
| 98 | Ga0466713_079548 | 3300042602 | Archaea | 1153 |
| 99 | Ga0466725_196961 | 3300042654 | Bacteria | 12907 |
| 100 | Ga0466727_031091 | 3300042655 | Archaea | 1139 |
| 101 | Ga0466727_265381 | 3300042655 | Bacteria | 2103 |
| 102 | Ga0466711_054493 | 3300042615 | Bacteria | 2846 |
| 103 | Ga0466711_257313 | 3300042615 | Archaea | 1877 |
| 104 | Ga0466711_369364 | 3300042615 | Bacteria | 1842 |
| 105 | Ga0466718_116322 | 3300042617 | Bacteria | 2859 |
| 106 | Ga0466726_096187 | 3300042619 | Bacteria | 9387 |
| 107 | JGI24702J35022_10036923 | 3300002462 | Bacteria | 2610 |
| 108 | JGI24702J35022_10076375 | 3300002462 | Bacteria | 1810 |
| 109 | Ga0068305_10758694 | 3300005083 | Bacteria | 1556 |
| 110 | Ga0074278_127329 | 3300005721 | Unclassified | 5580 |
| 111 | Ga0466705_100765 | 3300042612 | Bacteria | 29793 |
| 112 | Ga0466691_084797 | 3300042593 | Bacteria | 28408 |
| 113 | Ga0466700_362509 | 3300042600 | Bacteria | 109813 |
| 114 | Ga0466720_014370 | 3300042607 | Unclassified | 1417 |
| 115 | Ga0466722_083389 | 3300042609 | Bacteria | 4083 |
| 116 | Ga0466698_438750 | 3300042610 | Archaea | 1749 |
| 117 | Ga0466703_139213 | 3300042636 | Unclassified | 2224 |
| 118 | Ga0466703_220615 | 3300042636 | Bacteria | 9091 |
| 119 | Ga0466704_137630 | 3300042643 | Bacteria | 36327 |
| 120 | Ga0466708_132822 | 3300042652 | Bacteria | 34704 |
| 121 | Ga0466711_036113 | 3300042615 | Bacteria | 1799 |
| 122 | Ga0466715_512819 | 3300042616 | Bacteria | 10136 |
| 123 | Ga0466718_104496 | 3300042617 | Bacteria | 1031 |
| 124 | Ga0466726_114007 | 3300042619 | Archaea | 1662 |
| 125 | 2227665721 | 2225789004 | Bacteria | 1925 |
| 126 | Ga0415639_002187 | 3300038395 | Bacteria | 4279 |
| 127 | Ga0466693_306737 | 3300042592 | Bacteria | 1418 |
| 128 | Ga0466694_011345 | 3300042594 | Archaea | 1237 |
| 129 | Ga0466696_003079 | 3300042596 | Bacteria | 2073 |
| 130 | Ga0123353_10781155 | 3300010167 | Bacteria | 1323 |
| 131 | Ga0123354_10099923 | 3300010882 | Bacteria | 3932 |
| 132 | Ga0466706_166171 | 3300042599 | Bacteria | 2283 |
| 133 | Ga0466716_223519 | 3300042605 | Bacteria | 10973 |
| 134 | Ga0466716_251154 | 3300042605 | Bacteria | 2905 |
| 135 | Ga0466720_025462 | 3300042607 | Bacteria | 2010 |
| 136 | Ga0466722_262965 | 3300042609 | Bacteria | 1918 |
| 137 | Ga0466735_075003 | 3300042624 | Archaea | 1082 |
| 138 | Ga0466704_089251 | 3300042643 | Bacteria | 6996 |
| 139 | Ga0466708_334871 | 3300042652 | Bacteria | 10487 |
| 140 | Ga0466727_245296 | 3300042655 | Bacteria | 1431 |
| 141 | Ga0466718_096241 | 3300042617 | Bacteria | 5242 |
| 142 | IMNBL1DRAFT_c0008659 | 3300000062 | Bacteria | 5153 |
| 143 | HBC_ctgsDRAFT_1004230 | 3300000333 | Bacteria | 3314 |
| 144 | HBC_ctgsDRAFT_1004513 | 3300000333 | Unclassified | 3230 |
| 145 | JGI24695J34938_10004379 | 3300002450 | Unclassified | 9302 |
| 146 | JGI24695J34938_10018562 | 3300002450 | Bacteria | 3471 |
| 147 | JGI24695J34938_10044420 | 3300002450 | Unclassified | 1976 |
| 148 | JGI24702J35022_10001657 | 3300002462 | Bacteria | 13838 |
| 149 | Ga0466705_058326 | 3300042612 | Bacteria | 1417 |
| 150 | Ga0466733_172442 | 3300042659 | Unclassified | 1278 |
| 151 | Ga0466690_302228 | 3300042590 | Unclassified | 3080 |
| 152 | Ga0466692_093077 | 3300042591 | Bacteria | 8343 |
| 153 | Ga0466692_164470 | 3300042591 | Archaea | 1264 |
| 154 | Ga0466694_223353 | 3300042594 | Bacteria | 1121 |
| 155 | Ga0466720_024350 | 3300042607 | Unclassified | 1518 |
| 156 | Ga0466722_024613 | 3300042609 | Bacteria | 1130 |
| 157 | Ga0466698_517410 | 3300042610 | Bacteria | 1789 |
| 158 | Ga0466735_013617 | 3300042624 | Bacteria | 4842 |
| 159 | Ga0466735_133856 | 3300042624 | Bacteria | 1415 |
| 160 | Ga0466702_293135 | 3300042635 | Bacteria | 1151 |
| 161 | Ga0466704_118713 | 3300042643 | Unclassified | 8399 |
| 162 | Ga0466723_014667 | 3300042618 | Bacteria | 4666 |
| 163 | gam1t_NODE_642134_length=5580_GC=33_0_Contigs=1 | 2189573031 | Bacteria | 5580 |
| 164 | JGI24695J34938_10000610 | 3300002450 | Bacteria | 34310 |
| 165 | JGI24695J34938_10039437 | 3300002450 | Bacteria | 2134 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042591 | Ga0466692_089205 | Ga0466692_089205_1068_1808 | 246 |
| 2 | 3300042636 | Ga0466703_139213 | Ga0466703_139213_1380_2120 | 246 |
| 3 | 3300042605 | Ga0466716_007115 | Ga0466716_007115_25_810 | 261 |
| 4 | 3300042607 | Ga0466720_014370 | Ga0466720_014370_328_1131 | 267 |
| 5 | 3300042607 | Ga0466720_030206 | Ga0466720_030206_290_1123 | 277 |
| 6 | 3300042612 | Ga0466705_260038 | Ga0466705_260038_1122_1967 | 281 |
| 7 | 3300042622 | Ga0466731_254336 | Ga0466731_254336_839_1690 | 283 |
| 8 | 3300042610 | Ga0466698_517410 | Ga0466698_517410_434_1291 | 285 |
| 9 | 3300042591 | Ga0466692_110500 | Ga0466692_110500_468_1331 | 287 |
| 10 | 3300042635 | Ga0466702_293135 | Ga0466702_293135_32_895 | 287 |
| 11 | 3300042624 | Ga0466735_034696 | Ga0466735_034696_244_1110 | 288 |
| 12 | 3300042659 | Ga0466733_026086 | Ga0466733_026086_1609_2493 | 294 |
| 13 | 3300042592 | Ga0466693_306737 | Ga0466693_306737_337_1230 | 297 |
| 14 | 3300009826 | Ga0123355_10001660 | Ga0123355_1000166019 | 299 |
| 15 | 3300009826 | Ga0123355_10356989 | Ga0123355_103569892 | 299 |
| 16 | 3300002462 | JGI24702J35022_10001657 | JGI24702J35022_1000165710 | 300 |
| 17 | 3300002462 | JGI24702J35022_10030488 | JGI24702J35022_100304883 | 300 |
| 18 | 3300042624 | Ga0466735_013617 | Ga0466735_013617_2495_3427 | 300 |
| 19 | 3300042594 | Ga0466694_011738 | Ga0466694_011738_1106_2011 | 301 |
| 20 | 3300042603 | Ga0466714_038528 | Ga0466714_038528_1298_2203 | 301 |
| 21 | 3300042612 | Ga0466705_234594 | Ga0466705_234594_41525_42430 | 301 |
| 22 | 3300042615 | Ga0466711_054493 | Ga0466711_054493_1597_2502 | 301 |
| 23 | 3300042656 | Ga0466732_351611 | Ga0466732_351611_678_1583 | 301 |
| 24 | 3300002450 | JGI24695J34938_10007704 | JGI24695J34938_100077045 | 302 |
| 25 | 3300000062 | IMNBL1DRAFT_c0008153 | IMNBL1DRAFT_00081532 | 303 |
| 26 | 3300042607 | Ga0466720_024350 | Ga0466720_024350_247_1158 | 303 |
| 27 | 3300042619 | Ga0466726_433277 | Ga0466726_433277_53_964 | 303 |
| 28 | 3300010167 | Ga0123353_10366525 | Ga0123353_103665252 | 305 |
| 29 | 3300010167 | Ga0123353_10452310 | Ga0123353_104523103 | 305 |
| 30 | 3300042643 | Ga0466704_089251 | Ga0466704_089251_3769_4701 | 305 |
| 31 | 3300002450 | JGI24695J34938_10049260 | JGI24695J34938_100492602 | 306 |
| 32 | 3300042615 | Ga0466711_257313 | Ga0466711_257313_475_1395 | 306 |
| 33 | 2225789004 | 2227665721 | 2228268465 | 307 |
| 34 | 3300009826 | Ga0123355_10000891 | Ga0123355_1000089117 | 307 |
| 35 | 3300042593 | Ga0466691_009031 | Ga0466691_009031_4518_5441 | 307 |
| 36 | 3300042605 | Ga0466716_147864 | Ga0466716_147864_1654_2577 | 307 |
| 37 | 3300042610 | Ga0466698_308820 | Ga0466698_308820_122_1045 | 307 |
| 38 | 3300042618 | Ga0466723_014667 | Ga0466723_014667_2851_3774 | 307 |
| 39 | 3300042619 | Ga0466726_096187 | Ga0466726_096187_1406_2329 | 307 |
| 40 | 3300042624 | Ga0466735_039970 | Ga0466735_039970_2997_3920 | 307 |
| 41 | 3300042652 | Ga0466708_334871 | Ga0466708_334871_6791_7714 | 307 |
| 42 | 3300010882 | Ga0123354_10099923 | Ga0123354_100999233 | 308 |
| 43 | 3300038395 | Ga0415639_027425 | Ga0415639_027425_2206_3132 | 308 |
| 44 | 3300042615 | Ga0466711_383833 | Ga0466711_383833_5479_6420 | 308 |
| 45 | 3300042617 | Ga0466718_097932 | Ga0466718_097932_2000_2926 | 308 |
| 46 | 3300042643 | Ga0466704_499584 | Ga0466704_499584_464_1390 | 308 |
| 47 | 3300042655 | Ga0466727_265381 | Ga0466727_265381_927_1853 | 308 |
| 48 | 3300000062 | IMNBL1DRAFT_c0001841 | IMNBL1DRAFT_000184111 | 309 |
| 49 | 3300002450 | JGI24695J34938_10004379 | JGI24695J34938_100043798 | 309 |
| 50 | 3300042591 | Ga0466692_177534 | Ga0466692_177534_462_1391 | 309 |
| 51 | 3300042593 | Ga0466691_084797 | Ga0466691_084797_260_1189 | 309 |
| 52 | 3300042599 | Ga0466706_160411 | Ga0466706_160411_228_1157 | 309 |
| 53 | 3300042599 | Ga0466706_200351 | Ga0466706_200351_338_1267 | 309 |
| 54 | 3300042612 | Ga0466705_058326 | Ga0466705_058326_199_1128 | 309 |
| 55 | 3300042612 | Ga0466705_447940 | Ga0466705_447940_387_1316 | 309 |
| 56 | 3300042615 | Ga0466711_036113 | Ga0466711_036113_519_1448 | 309 |
| 57 | 3300042615 | Ga0466711_150844 | Ga0466711_150844_279_1208 | 309 |
| 58 | 3300042615 | Ga0466711_283000 | Ga0466711_283000_1757_2686 | 309 |
| 59 | 3300042618 | Ga0466723_193754 | Ga0466723_193754_11316_12245 | 309 |
| 60 | 3300042636 | Ga0466703_004670 | Ga0466703_004670_2715_3644 | 309 |
| 61 | 3300042636 | Ga0466703_220615 | Ga0466703_220615_6555_7484 | 309 |
| 62 | 3300042656 | Ga0466732_165573 | Ga0466732_165573_168_1097 | 309 |
| 63 | 2189573031 | gam1t_NODE_619022_length=6948_GC=31_3_Contigs=4 | gam1t_00003000 | 310 |
| 64 | 2189573031 | gam1t_NODE_642134_length=5580_GC=33_0_Contigs=1 | gam1t_00010610 | 310 |
| 65 | 3300002450 | JGI24695J34938_10018562 | JGI24695J34938_100185622 | 310 |
| 66 | 3300038395 | Ga0415639_002187 | Ga0415639_002187_3288_4220 | 310 |
| 67 | 3300042590 | Ga0466690_019169 | Ga0466690_019169_1777_2709 | 310 |
| 68 | 3300042590 | Ga0466690_302228 | Ga0466690_302228_1074_2006 | 310 |
| 69 | 3300042593 | Ga0466691_205313 | Ga0466691_205313_1896_2828 | 310 |
| 70 | 3300042594 | Ga0466694_011345 | Ga0466694_011345_135_1067 | 310 |
| 71 | 3300042594 | Ga0466694_223353 | Ga0466694_223353_46_978 | 310 |
| 72 | 3300042594 | Ga0466694_379747 | Ga0466694_379747_21_953 | 310 |
| 73 | 3300042596 | Ga0466696_003079 | Ga0466696_003079_705_1637 | 310 |
| 74 | 3300042596 | Ga0466696_008317 | Ga0466696_008317_396_1328 | 310 |
| 75 | 3300042605 | Ga0466716_223519 | Ga0466716_223519_176_1108 | 310 |
| 76 | 3300042607 | Ga0466720_025462 | Ga0466720_025462_247_1179 | 310 |
| 77 | 3300042607 | Ga0466720_217205 | Ga0466720_217205_20311_21243 | 310 |
| 78 | 3300042609 | Ga0466722_024613 | Ga0466722_024613_178_1110 | 310 |
| 79 | 3300042609 | Ga0466722_083389 | Ga0466722_083389_2725_3657 | 310 |
| 80 | 3300042609 | Ga0466722_262965 | Ga0466722_262965_587_1519 | 310 |
| 81 | 3300042610 | Ga0466698_140163 | Ga0466698_140163_293_1225 | 310 |
| 82 | 3300042610 | Ga0466698_438750 | Ga0466698_438750_71_1003 | 310 |
| 83 | 3300042612 | Ga0466705_445340 | Ga0466705_445340_9907_10839 | 310 |
| 84 | 3300042615 | Ga0466711_280934 | Ga0466711_280934_4869_5801 | 310 |
| 85 | 3300042615 | Ga0466711_433051 | Ga0466711_433051_647_1579 | 310 |
| 86 | 3300042616 | Ga0466715_121188 | Ga0466715_121188_1040_1972 | 310 |
| 87 | 3300042617 | Ga0466718_000859 | Ga0466718_000859_908_1840 | 310 |
| 88 | 3300042617 | Ga0466718_096241 | Ga0466718_096241_2293_3225 | 310 |
| 89 | 3300042618 | Ga0466723_017694 | Ga0466723_017694_1744_2676 | 310 |
| 90 | 3300042624 | Ga0466735_075003 | Ga0466735_075003_140_1072 | 310 |
| 91 | 3300042636 | Ga0466703_032402 | Ga0466703_032402_2749_3681 | 310 |
| 92 | 3300042643 | Ga0466704_137630 | Ga0466704_137630_32387_33319 | 310 |
| 93 | 3300042652 | Ga0466708_102916 | Ga0466708_102916_1062_1994 | 310 |
| 94 | 3300042652 | Ga0466708_132822 | Ga0466708_132822_1605_2537 | 310 |
| 95 | 3300042652 | Ga0466708_295739 | Ga0466708_295739_1092_2024 | 310 |
| 96 | 3300042656 | Ga0466732_104607 | Ga0466732_104607_415_1347 | 310 |
| 97 | 3300042659 | Ga0466733_172442 | Ga0466733_172442_44_976 | 310 |
| 98 | iso_pr_bacteria | 2515154047 | 2515333595 | 310 |
| 99 | iso_pr_bacteria | 2515154047 | 2515333598 | 310 |
| 100 | iso_pr_bacteria | 2684622923 | 2686095915 | 310 |
| 101 | iso_pr_bacteria | 2684622924 | 2686098857 | 310 |
| 102 | iso_pr_bacteria | 2684622925 | 2686101194 | 310 |
| 103 | iso_pr_bacteria | 2684622926 | 2686104513 | 310 |
| 104 | iso_pr_bacteria | 2756170265 | 2756752763 | 310 |
| 105 | iso_pr_bacteria | 2781125630 | 2781267022 | 310 |
| 106 | iso_pr_bacteria | 2837615801 | 2837617510 | 310 |
| 107 | iso_pr_bacteria | 2837618715 | 2837620849 | 310 |
| 108 | iso_pr_bacteria | 2838840603 | 2838840973 | 310 |
| 109 | iso_pr_bacteria | 2841195917 | 2841196251 | 310 |
| 110 | iso_pr_bacteria | 2843334863 | 2843337401 | 310 |
| 111 | iso_pr_bacteria | 2846472545 | 2846473384 | 310 |
| 112 | iso_pr_bacteria | 2846475167 | 2846476914 | 310 |
| 113 | iso_pr_bacteria | 2846490831 | 2846492068 | 310 |
| 114 | iso_pr_bacteria | 2846495668 | 2846496846 | 310 |
| 115 | iso_pr_bacteria | 2849452216 | 2849453045 | 310 |
| 116 | iso_pr_bacteria | 2849463436 | 2849464194 | 310 |
| 117 | iso_pr_bacteria | 2854141978 | 2854143337 | 310 |
| 118 | iso_pr_bacteria | 2857870431 | 2857871209 | 310 |
| 119 | iso_pr_bacteria | 2857883421 | 2857884822 | 310 |
| 120 | iso_pr_bacteria | 2868486652 | 2868486762 | 310 |
| 121 | iso_pr_bacteria | 2868489326 | 2868489608 | 310 |
| 122 | iso_pr_bacteria | 2870897478 | 2870899902 | 310 |
| 123 | iso_pr_bacteria | 2873656248 | 2873658683 | 310 |
| 124 | iso_pr_bacteria | 2876016455 | 2876017523 | 310 |
| 125 | iso_pr_bacteria | 2876019154 | 2876021055 | 310 |
| 126 | iso_pr_bacteria | 2876022486 | 2876025137 | 310 |
| 127 | iso_pr_bacteria | 8088486376 | 8088488026 | 310 |
| 128 | iso_pr_bacteria | 8088491222 | 8088492957 | 310 |
| 129 | iso_pr_bacteria | 8088493931 | 8088495545 | 310 |
| 130 | 3300000333 | HBC_ctgsDRAFT_1004230 | HBC_ctgsDRAFT_10042301 | 311 |
| 131 | 3300000333 | HBC_ctgsDRAFT_1004513 | HBC_ctgsDRAFT_10045134 | 311 |
| 132 | 3300000473 | SCG598I20_12783 | SCG598I20_1278323 | 311 |
| 133 | 3300000490 | SCG598L16_115148 | SCG598L16_1151486 | 311 |
| 134 | 3300002449 | JGI24698J34947_10003555 | JGI24698J34947_100035554 | 311 |
| 135 | 3300002449 | JGI24698J34947_10043139 | JGI24698J34947_100431392 | 311 |
| 136 | 3300005485 | Ga0074263_115093 | Ga0074263_1150933 | 311 |
| 137 | 3300005721 | Ga0074278_102689 | Ga0074278_1026899 | 311 |
| 138 | 3300005721 | Ga0074278_116492 | Ga0074278_1164927 | 311 |
| 139 | 3300005721 | Ga0074278_127329 | Ga0074278_1273295 | 311 |
| 140 | iso_pr_bacteria | 2781125661 | 2781334143 | 311 |
| 141 | iso_pr_bacteria | 2781125682 | 2781409813 | 311 |
| 142 | iso_pr_bacteria | 2820013017 | 2820013484 | 311 |
| 143 | 3300002450 | JGI24695J34938_10027030 | JGI24695J34938_100270301 | 312 |
| 144 | 3300002450 | JGI24695J34938_10044420 | JGI24695J34938_100444201 | 312 |
| 145 | 3300042591 | Ga0466692_164470 | Ga0466692_164470_208_1146 | 312 |
| 146 | 3300042596 | Ga0466696_375808 | Ga0466696_375808_1858_2796 | 312 |
| 147 | 3300042602 | Ga0466713_065914 | Ga0466713_065914_6260_7198 | 312 |
| 148 | 3300042602 | Ga0466713_070548 | Ga0466713_070548_858_1796 | 312 |
| 149 | 3300042602 | Ga0466713_079548 | Ga0466713_079548_153_1091 | 312 |
| 150 | 3300042607 | Ga0466720_079266 | Ga0466720_079266_4670_5608 | 312 |
| 151 | 3300042612 | Ga0466705_340718 | Ga0466705_340718_166_1104 | 312 |
| 152 | 3300042612 | Ga0466705_471587 | Ga0466705_471587_5469_6407 | 312 |
| 153 | 3300042643 | Ga0466704_235607 | Ga0466704_235607_7288_8226 | 312 |
| 154 | 3300000062 | IMNBL1DRAFT_c0008659 | IMNBL1DRAFT_00086593 | 313 |
| 155 | 3300042601 | Ga0466707_189775 | Ga0466707_189775_28_969 | 313 |
| 156 | 3300042648 | Ga0466709_397457 | Ga0466709_397457_7531_8472 | 313 |
| 157 | iso_pr_bacteria | 2590828841 | 2593260622 | 313 |
| 158 | iso_pr_bacteria | 2820507989 | 2820509454 | 313 |
| 159 | 3300002450 | JGI24695J34938_10039437 | JGI24695J34938_100394371 | 314 |
| 160 | 3300005083 | Ga0068305_10758694 | Ga0068305_107586941 | 314 |
| 161 | 3300042599 | Ga0466706_029872 | Ga0466706_029872_3508_4452 | 314 |
| 162 | 3300042602 | Ga0466713_003122 | Ga0466713_003122_17_961 | 314 |
| 163 | 3300042612 | Ga0466705_100765 | Ga0466705_100765_18862_19806 | 314 |
| 164 | 3300042617 | Ga0466718_104496 | Ga0466718_104496_56_1000 | 314 |
| 165 | 3300042617 | Ga0466718_116322 | Ga0466718_116322_350_1294 | 314 |
| 166 | 3300042617 | Ga0466718_162941 | Ga0466718_162941_805_1749 | 314 |
| 167 | 3300042624 | Ga0466735_164788 | Ga0466735_164788_194_1138 | 314 |
| 168 | iso_pr_bacteria | 2585428085 | 2587836877 | 314 |
| 169 | iso_pr_bacteria | 2781125650 | 2781308074 | 314 |
| 170 | 3300002450 | JGI24695J34938_10013658 | JGI24695J34938_100136584 | 315 |
| 171 | 3300002462 | JGI24702J35022_10076375 | JGI24702J35022_100763751 | 315 |
| 172 | 3300042596 | Ga0466696_213173 | Ga0466696_213173_5690_6637 | 315 |
| 173 | 3300042599 | Ga0466706_166171 | Ga0466706_166171_1116_2063 | 315 |
| 174 | 3300042619 | Ga0466726_114007 | Ga0466726_114007_613_1560 | 315 |
| 175 | 3300042620 | Ga0466728_313732 | Ga0466728_313732_217_1164 | 315 |
| 176 | 3300042655 | Ga0466727_245296 | Ga0466727_245296_372_1319 | 315 |
| 177 | iso_pr_bacteria | 2820666966 | 2820668879 | 315 |
| 178 | 3300002450 | JGI24695J34938_10000610 | JGI24695J34938_1000061014 | 316 |
| 179 | 3300002509 | JGI24699J35502_11133779 | JGI24699J35502_111337798 | 316 |
| 180 | 3300042593 | Ga0466691_029356 | Ga0466691_029356_138_1088 | 316 |
| 181 | 3300042601 | Ga0466707_012858 | Ga0466707_012858_7289_8239 | 316 |
| 182 | 3300042643 | Ga0466704_118713 | Ga0466704_118713_2736_3686 | 316 |
| 183 | iso_pr_bacteria | 2820277137 | 2820279521 | 316 |
| 184 | 3300010167 | Ga0123353_10781155 | Ga0123353_107811552 | 317 |
| 185 | 3300042619 | Ga0466726_208665 | Ga0466726_208665_221_1174 | 317 |
| 186 | 3300042605 | Ga0466716_251154 | Ga0466716_251154_895_1851 | 318 |
| 187 | 3300042636 | Ga0466703_397811 | Ga0466703_397811_46561_47517 | 318 |
| 188 | 3300042654 | Ga0466725_196961 | Ga0466725_196961_9245_10201 | 318 |
| 189 | 3300042615 | Ga0466711_369364 | Ga0466711_369364_739_1698 | 319 |
| 190 | 3300042620 | Ga0466728_022521 | Ga0466728_022521_399_1358 | 319 |
| 191 | 3300042643 | Ga0466704_498154 | Ga0466704_498154_1887_2846 | 319 |
| 192 | 3300042600 | Ga0466700_362509 | Ga0466700_362509_94573_95535 | 320 |
| 193 | 3300042624 | Ga0466735_133856 | Ga0466735_133856_150_1112 | 320 |
| 194 | 3300042655 | Ga0466727_031091 | Ga0466727_031091_139_1104 | 321 |
| 195 | 3300042616 | Ga0466715_512819 | Ga0466715_512819_8923_9891 | 322 |
| 196 | 3300042619 | Ga0466726_017517 | Ga0466726_017517_1323_2291 | 322 |
| 197 | 3300042619 | Ga0466726_208889 | Ga0466726_208889_3185_4153 | 322 |
| 198 | 3300042655 | Ga0466727_051845 | Ga0466727_051845_50_1018 | 322 |
| 199 | 3300042591 | Ga0466692_093077 | Ga0466692_093077_452_1423 | 323 |
| 200 | 3300042599 | Ga0466706_078767 | Ga0466706_078767_77_1060 | 327 |
| 201 | 3300002462 | JGI24702J35022_10036923 | JGI24702J35022_100369232 | 328 |
| 202 | 3300042599 | Ga0466706_197231 | Ga0466706_197231_237_1226 | 329 |
| 203 | 3300042592 | Ga0466693_134287 | Ga0466693_134287_153_1157 | 334 |
| 204 | iso_pr_bacteria | 2820762746 | 2820763224 | 334 |
| 205 | 3300042648 | Ga0466709_084178 | Ga0466709_084178_6865_7878 | 337 |
| 206 | 3300042618 | Ga0466723_133564 | Ga0466723_133564_244_1266 | 340 |
| 207 | 3300042619 | Ga0466726_168696 | Ga0466726_168696_538_1662 | 374 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF08902 | DUF1848 | Domain of unknown function (DUF1848) | 66 | 327 | 0.99 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.79 | 0.83 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.