Protein Family IF08249

Metagenome Isolate
207 Members
91 Samples
165 Scaffolds
309.59 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_168696|Ga0466726_168696_538_1662
Length
374 aa
Sequence
MYLMEAYPYMLVIHENFTQIIHRSQGMVGYKYQKWILFILSVAMEIFLRRILLRKAYSLNTGNIVIISASRRTDVPAYYSDWLLNRIKERYVYVRNPMNIHQISKINLSPDVVDCIVFWSKNPKPMLDKLQFLNEYAYYFQFTLNPYDKDIEIRLPCKNEILEIFKKLSDIISPSKIIWRYDPVLLNKKYTISYHIDKFFEYAVKLKGYTEKVTFSFIDFYKKITENIKFAEMNEITYEEKNIIADNFSRIAKESNLLIDTCAEDIDLLKYNIAHARCIDDKLIAKIIGYNFFAEKDRNQRLECGCVGSIDIGEYNSCSNGCVYCYANYGQNVVKNNLKKHNKLLPLLIGEINEDDIINERKVVSNKILQKELL

📊 Sample Types

Isolate 20.3%
Metagenome 79.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Apidae 33.0%
Termitidae 25.3%
Unclassified 18.7%
Kalotermitidae 14.3%
Termopsidae 3.3%
Rhinotermitidae 2.2%
Passalidae 2.2%
Hodotermitidae 1.1%

🌳 Taxonomy

Archaea 8
Bacteria 182
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2590828841 Oscillospiraceae bacterium Ne3 Isolate Termitidae
2 2756170265 Gilliamella apicola DSM 104097 Isolate Unclassified
3 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
4 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
5 2849463436 Gilliamella apicola A-8-12 Isolate Apidae
6 2873656248 Gilliamella apicola A-1-24 Isolate Apidae
7 2876016455 Gilliamella apicola N6 Isolate Apidae
8 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
9 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
10 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
14 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
15 8088486376 Gilliamella apis ESL0172 Isolate Apidae
16 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
17 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
18 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
19 2515154047 Candidatus Gilliamella apicola wkB1 Isolate Apidae
20 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
21 2684622923 Gilliamella apicola Ga_172 Isolate Unclassified
22 2684622925 Gilliamella apicola Ga_178 Isolate Unclassified
23 2684622926 Gilliamella apicola Ga_182 Isolate Unclassified
24 2857870431 Gilliamella apicola A-7-24 Isolate Apidae
25 2876019154 Gilliamella apicola ESL0182 Isolate Apidae
26 3300000473 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 Metagenome Apidae
27 3300000490 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 Metagenome Apidae
28 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
29 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
30 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
31 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
32 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
33 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
34 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
35 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
36 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
37 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
38 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
39 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
40 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
41 2843334863 Gilliamella apicola A-2-24 Isolate Apidae
42 2846490831 Gilliamella apis ESL0172 Isolate Apidae
43 2857883421 Gilliamella apicola N2 Isolate Apidae
44 2868486652 Gilliamella sp. N-G2 Isolate Apidae
45 2870897478 Gilliamella apicola A-7-12 Isolate Apidae
46 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
47 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
48 2837618715 Gilliamella apicola Aw-17 Isolate Apidae
49 2841195917 Gilliamella apicola wkB7 Isolate Apidae
50 2846495668 Gilliamella apicola ESL0178 Isolate Apidae
51 2849452216 Gilliamella apicola AW11 Isolate Apidae
52 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
53 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
54 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
55 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
56 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
57 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
58 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
59 2837615801 Gilliamella apicola ESL0177 Isolate Apidae
60 2876022486 Gilliamella apicola A8 Isolate Apidae
61 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
62 8088491222 Gilliamella apicola ESL0178 Isolate Apidae
63 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
64 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
65 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
66 2189573031 Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. Metagenome Apidae
67 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
68 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
69 2846472545 Gilliamella sp. N-W3 Isolate Apidae
70 2846475167 Gilliamella apicola N-G5 Isolate Apidae
71 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
72 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
73 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
74 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
75 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
76 2854141978 Gilliamella apicola A-12-12 Isolate Apidae
77 2868489326 Gilliamella apicola N10 Isolate Apidae
78 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
79 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
80 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
81 8088493931 Gilliamella apis K-MP18 Isolate Apidae
82 2684622924 Gilliamella apicola Ga_177 Isolate Unclassified
83 2820013017 Unclassified Spirochaetes Th196P3bin152 Isolate Unclassified
84 2838840603 Gilliamella apicola A-9-12 Isolate Apidae
85 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
86 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
87 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
88 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
89 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
90 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
91 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_026086 3300042659 Bacteria 2560
2 Ga0466690_019169 3300042590 Bacteria 3240
3 Ga0466692_110500 3300042591 Bacteria 1392
4 Ga0466696_008317 3300042596 Bacteria 3084
5 Ga0466706_078767 3300042599 Bacteria 2598
6 Ga0466720_217205 3300042607 Bacteria 23129
7 Ga0466735_039970 3300042624 Bacteria 3971
8 Ga0466703_032402 3300042636 Bacteria 4434
9 Ga0466704_235607 3300042643 Bacteria 13509
10 Ga0466704_498154 3300042643 Bacteria 2919
11 Ga0466727_051845 3300042655 Bacteria 3518
12 Ga0466726_208889 3300042619 Bacteria 14929
13 Ga0466726_433277 3300042619 Bacteria 1078
14 SCG598I20_12783 3300000473 Bacteria 86326
15 JGI24695J34938_10049260 3300002450 Bacteria 1852
16 JGI24702J35022_10030488 3300002462 Bacteria 2894
17 Ga0074263_115093 3300005485 Bacteria 5118
18 Ga0466705_234594 3300042612 Bacteria 119076
19 Ga0466692_089205 3300042591 Unclassified 1824
20 Ga0466691_009031 3300042593 Bacteria 6698
21 Ga0466691_205313 3300042593 Bacteria 3053
22 Ga0466694_379747 3300042594 Bacteria 1006
23 Ga0123353_10452310 3300010167 Bacteria 1890
24 Ga0466713_070548 3300042602 Bacteria 6449
25 Ga0466716_147864 3300042605 Bacteria 2655
26 Ga0466698_308820 3300042610 Bacteria 1308
27 Ga0466704_499584 3300042643 Bacteria 2688
28 Ga0466705_471587 3300042612 Unclassified 11072
29 Ga0466711_383833 3300042615 Bacteria 8870
30 Ga0466711_433051 3300042615 Bacteria 6432
31 Ga0466718_097932 3300042617 Bacteria 4881
32 Ga0466723_133564 3300042618 Bacteria 1778
33 Ga0466723_193754 3300042618 Bacteria 13053
34 Ga0466726_168696 3300042619 Bacteria 2025
35 JGI24698J34947_10003555 3300002449 Bacteria 8461
36 Ga0466705_260038 3300042612 Unclassified 7427
37 Ga0466705_340718 3300042612 Bacteria 1140
38 Ga0466732_104607 3300042656 Bacteria 1596
39 Ga0466732_351611 3300042656 Bacteria 2129
40 Ga0466693_134287 3300042592 Bacteria 1247
41 Ga0123355_10000891 3300009826 Bacteria 41353
42 Ga0466706_029872 3300042599 Bacteria 7306
43 Ga0466706_160411 3300042599 Bacteria 2819
44 Ga0466706_197231 3300042599 Bacteria 1524
45 Ga0466706_200351 3300042599 Bacteria 1300
46 Ga0466714_038528 3300042603 Bacteria 3021
47 Ga0466716_007115 3300042605 Unclassified 1243
48 Ga0466720_079266 3300042607 Bacteria 13517
49 Ga0466698_140163 3300042610 Bacteria 4337
50 Ga0466735_164788 3300042624 Bacteria 1153
51 Ga0466703_004670 3300042636 Bacteria 4798
52 Ga0466709_084178 3300042648 Bacteria 96335
53 Ga0466709_397457 3300042648 Bacteria 13705
54 Ga0466708_102916 3300042652 Bacteria 2189
55 Ga0466708_295739 3300042652 Bacteria 3660
56 Ga0466705_445340 3300042612 Bacteria 14158
57 Ga0466705_447940 3300042612 Bacteria 2598
58 Ga0466711_283000 3300042615 Bacteria 27306
59 Ga0466715_121188 3300042616 Bacteria 2336
60 Ga0466718_162941 3300042617 Bacteria 1796
61 Ga0466723_017694 3300042618 Bacteria 20517
62 Ga0466728_022521 3300042620 Bacteria 2134
63 JGI24695J34938_10007704 3300002450 Bacteria 6248
64 Ga0466732_165573 3300042656 Bacteria 1634
65 Ga0466692_177534 3300042591 Bacteria 2755
66 Ga0466691_029356 3300042593 Bacteria 2139
67 Ga0466707_012858 3300042601 Bacteria 8548
68 Ga0466713_003122 3300042602 Bacteria 1306
69 Ga0466720_030206 3300042607 Bacteria 1496
70 Ga0466731_254336 3300042622 Bacteria 1974
71 Ga0466735_034696 3300042624 Unclassified 1145
72 Ga0466703_397811 3300042636 Bacteria 83754
73 Ga0466711_150844 3300042615 Bacteria 1810
74 Ga0466711_280934 3300042615 Bacteria 6127
75 Ga0466718_000859 3300042617 Bacteria 3112
76 Ga0466726_017517 3300042619 Bacteria 3424
77 Ga0466726_208665 3300042619 Bacteria 1691
78 Ga0466728_313732 3300042620 Bacteria 1224
79 gam1t_NODE_619022_length=6948_GC=31_3_Contigs=4 2189573031 Bacteria 6978
80 IMNBL1DRAFT_c0001841 3300000062 Bacteria 15454
81 IMNBL1DRAFT_c0008153 3300000062 Bacteria 5384
82 SCG598L16_115148 3300000490 Unclassified 8938
83 JGI24698J34947_10043139 3300002449 Bacteria 2314
84 JGI24695J34938_10013658 3300002450 Bacteria 4253
85 JGI24695J34938_10027030 3300002450 Bacteria 2718
86 JGI24699J35502_11133779 3300002509 Bacteria 15459
87 Ga0074278_102689 3300005721 Bacteria 12077
88 Ga0074278_116492 3300005721 Unclassified 6978
89 Ga0415639_027425 3300038395 Bacteria 4823
90 Ga0466694_011738 3300042594 Bacteria 3255
91 Ga0466696_213173 3300042596 Bacteria 7451
92 Ga0466696_375808 3300042596 Bacteria 2919
93 Ga0123355_10001660 3300009826 Bacteria 30968
94 Ga0123355_10356989 3300009826 Bacteria 1930
95 Ga0123353_10366525 3300010167 Bacteria 2162
96 Ga0466707_189775 3300042601 Bacteria 25069
97 Ga0466713_065914 3300042602 Bacteria 9883
98 Ga0466713_079548 3300042602 Archaea 1153
99 Ga0466725_196961 3300042654 Bacteria 12907
100 Ga0466727_031091 3300042655 Archaea 1139
101 Ga0466727_265381 3300042655 Bacteria 2103
102 Ga0466711_054493 3300042615 Bacteria 2846
103 Ga0466711_257313 3300042615 Archaea 1877
104 Ga0466711_369364 3300042615 Bacteria 1842
105 Ga0466718_116322 3300042617 Bacteria 2859
106 Ga0466726_096187 3300042619 Bacteria 9387
107 JGI24702J35022_10036923 3300002462 Bacteria 2610
108 JGI24702J35022_10076375 3300002462 Bacteria 1810
109 Ga0068305_10758694 3300005083 Bacteria 1556
110 Ga0074278_127329 3300005721 Unclassified 5580
111 Ga0466705_100765 3300042612 Bacteria 29793
112 Ga0466691_084797 3300042593 Bacteria 28408
113 Ga0466700_362509 3300042600 Bacteria 109813
114 Ga0466720_014370 3300042607 Unclassified 1417
115 Ga0466722_083389 3300042609 Bacteria 4083
116 Ga0466698_438750 3300042610 Archaea 1749
117 Ga0466703_139213 3300042636 Unclassified 2224
118 Ga0466703_220615 3300042636 Bacteria 9091
119 Ga0466704_137630 3300042643 Bacteria 36327
120 Ga0466708_132822 3300042652 Bacteria 34704
121 Ga0466711_036113 3300042615 Bacteria 1799
122 Ga0466715_512819 3300042616 Bacteria 10136
123 Ga0466718_104496 3300042617 Bacteria 1031
124 Ga0466726_114007 3300042619 Archaea 1662
125 2227665721 2225789004 Bacteria 1925
126 Ga0415639_002187 3300038395 Bacteria 4279
127 Ga0466693_306737 3300042592 Bacteria 1418
128 Ga0466694_011345 3300042594 Archaea 1237
129 Ga0466696_003079 3300042596 Bacteria 2073
130 Ga0123353_10781155 3300010167 Bacteria 1323
131 Ga0123354_10099923 3300010882 Bacteria 3932
132 Ga0466706_166171 3300042599 Bacteria 2283
133 Ga0466716_223519 3300042605 Bacteria 10973
134 Ga0466716_251154 3300042605 Bacteria 2905
135 Ga0466720_025462 3300042607 Bacteria 2010
136 Ga0466722_262965 3300042609 Bacteria 1918
137 Ga0466735_075003 3300042624 Archaea 1082
138 Ga0466704_089251 3300042643 Bacteria 6996
139 Ga0466708_334871 3300042652 Bacteria 10487
140 Ga0466727_245296 3300042655 Bacteria 1431
141 Ga0466718_096241 3300042617 Bacteria 5242
142 IMNBL1DRAFT_c0008659 3300000062 Bacteria 5153
143 HBC_ctgsDRAFT_1004230 3300000333 Bacteria 3314
144 HBC_ctgsDRAFT_1004513 3300000333 Unclassified 3230
145 JGI24695J34938_10004379 3300002450 Unclassified 9302
146 JGI24695J34938_10018562 3300002450 Bacteria 3471
147 JGI24695J34938_10044420 3300002450 Unclassified 1976
148 JGI24702J35022_10001657 3300002462 Bacteria 13838
149 Ga0466705_058326 3300042612 Bacteria 1417
150 Ga0466733_172442 3300042659 Unclassified 1278
151 Ga0466690_302228 3300042590 Unclassified 3080
152 Ga0466692_093077 3300042591 Bacteria 8343
153 Ga0466692_164470 3300042591 Archaea 1264
154 Ga0466694_223353 3300042594 Bacteria 1121
155 Ga0466720_024350 3300042607 Unclassified 1518
156 Ga0466722_024613 3300042609 Bacteria 1130
157 Ga0466698_517410 3300042610 Bacteria 1789
158 Ga0466735_013617 3300042624 Bacteria 4842
159 Ga0466735_133856 3300042624 Bacteria 1415
160 Ga0466702_293135 3300042635 Bacteria 1151
161 Ga0466704_118713 3300042643 Unclassified 8399
162 Ga0466723_014667 3300042618 Bacteria 4666
163 gam1t_NODE_642134_length=5580_GC=33_0_Contigs=1 2189573031 Bacteria 5580
164 JGI24695J34938_10000610 3300002450 Bacteria 34310
165 JGI24695J34938_10039437 3300002450 Bacteria 2134

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042591 Ga0466692_089205 Ga0466692_089205_1068_1808 246
2 3300042636 Ga0466703_139213 Ga0466703_139213_1380_2120 246
3 3300042605 Ga0466716_007115 Ga0466716_007115_25_810 261
4 3300042607 Ga0466720_014370 Ga0466720_014370_328_1131 267
5 3300042607 Ga0466720_030206 Ga0466720_030206_290_1123 277
6 3300042612 Ga0466705_260038 Ga0466705_260038_1122_1967 281
7 3300042622 Ga0466731_254336 Ga0466731_254336_839_1690 283
8 3300042610 Ga0466698_517410 Ga0466698_517410_434_1291 285
9 3300042591 Ga0466692_110500 Ga0466692_110500_468_1331 287
10 3300042635 Ga0466702_293135 Ga0466702_293135_32_895 287
11 3300042624 Ga0466735_034696 Ga0466735_034696_244_1110 288
12 3300042659 Ga0466733_026086 Ga0466733_026086_1609_2493 294
13 3300042592 Ga0466693_306737 Ga0466693_306737_337_1230 297
14 3300009826 Ga0123355_10001660 Ga0123355_1000166019 299
15 3300009826 Ga0123355_10356989 Ga0123355_103569892 299
16 3300002462 JGI24702J35022_10001657 JGI24702J35022_1000165710 300
17 3300002462 JGI24702J35022_10030488 JGI24702J35022_100304883 300
18 3300042624 Ga0466735_013617 Ga0466735_013617_2495_3427 300
19 3300042594 Ga0466694_011738 Ga0466694_011738_1106_2011 301
20 3300042603 Ga0466714_038528 Ga0466714_038528_1298_2203 301
21 3300042612 Ga0466705_234594 Ga0466705_234594_41525_42430 301
22 3300042615 Ga0466711_054493 Ga0466711_054493_1597_2502 301
23 3300042656 Ga0466732_351611 Ga0466732_351611_678_1583 301
24 3300002450 JGI24695J34938_10007704 JGI24695J34938_100077045 302
25 3300000062 IMNBL1DRAFT_c0008153 IMNBL1DRAFT_00081532 303
26 3300042607 Ga0466720_024350 Ga0466720_024350_247_1158 303
27 3300042619 Ga0466726_433277 Ga0466726_433277_53_964 303
28 3300010167 Ga0123353_10366525 Ga0123353_103665252 305
29 3300010167 Ga0123353_10452310 Ga0123353_104523103 305
30 3300042643 Ga0466704_089251 Ga0466704_089251_3769_4701 305
31 3300002450 JGI24695J34938_10049260 JGI24695J34938_100492602 306
32 3300042615 Ga0466711_257313 Ga0466711_257313_475_1395 306
33 2225789004 2227665721 2228268465 307
34 3300009826 Ga0123355_10000891 Ga0123355_1000089117 307
35 3300042593 Ga0466691_009031 Ga0466691_009031_4518_5441 307
36 3300042605 Ga0466716_147864 Ga0466716_147864_1654_2577 307
37 3300042610 Ga0466698_308820 Ga0466698_308820_122_1045 307
38 3300042618 Ga0466723_014667 Ga0466723_014667_2851_3774 307
39 3300042619 Ga0466726_096187 Ga0466726_096187_1406_2329 307
40 3300042624 Ga0466735_039970 Ga0466735_039970_2997_3920 307
41 3300042652 Ga0466708_334871 Ga0466708_334871_6791_7714 307
42 3300010882 Ga0123354_10099923 Ga0123354_100999233 308
43 3300038395 Ga0415639_027425 Ga0415639_027425_2206_3132 308
44 3300042615 Ga0466711_383833 Ga0466711_383833_5479_6420 308
45 3300042617 Ga0466718_097932 Ga0466718_097932_2000_2926 308
46 3300042643 Ga0466704_499584 Ga0466704_499584_464_1390 308
47 3300042655 Ga0466727_265381 Ga0466727_265381_927_1853 308
48 3300000062 IMNBL1DRAFT_c0001841 IMNBL1DRAFT_000184111 309
49 3300002450 JGI24695J34938_10004379 JGI24695J34938_100043798 309
50 3300042591 Ga0466692_177534 Ga0466692_177534_462_1391 309
51 3300042593 Ga0466691_084797 Ga0466691_084797_260_1189 309
52 3300042599 Ga0466706_160411 Ga0466706_160411_228_1157 309
53 3300042599 Ga0466706_200351 Ga0466706_200351_338_1267 309
54 3300042612 Ga0466705_058326 Ga0466705_058326_199_1128 309
55 3300042612 Ga0466705_447940 Ga0466705_447940_387_1316 309
56 3300042615 Ga0466711_036113 Ga0466711_036113_519_1448 309
57 3300042615 Ga0466711_150844 Ga0466711_150844_279_1208 309
58 3300042615 Ga0466711_283000 Ga0466711_283000_1757_2686 309
59 3300042618 Ga0466723_193754 Ga0466723_193754_11316_12245 309
60 3300042636 Ga0466703_004670 Ga0466703_004670_2715_3644 309
61 3300042636 Ga0466703_220615 Ga0466703_220615_6555_7484 309
62 3300042656 Ga0466732_165573 Ga0466732_165573_168_1097 309
63 2189573031 gam1t_NODE_619022_length=6948_GC=31_3_Contigs=4 gam1t_00003000 310
64 2189573031 gam1t_NODE_642134_length=5580_GC=33_0_Contigs=1 gam1t_00010610 310
65 3300002450 JGI24695J34938_10018562 JGI24695J34938_100185622 310
66 3300038395 Ga0415639_002187 Ga0415639_002187_3288_4220 310
67 3300042590 Ga0466690_019169 Ga0466690_019169_1777_2709 310
68 3300042590 Ga0466690_302228 Ga0466690_302228_1074_2006 310
69 3300042593 Ga0466691_205313 Ga0466691_205313_1896_2828 310
70 3300042594 Ga0466694_011345 Ga0466694_011345_135_1067 310
71 3300042594 Ga0466694_223353 Ga0466694_223353_46_978 310
72 3300042594 Ga0466694_379747 Ga0466694_379747_21_953 310
73 3300042596 Ga0466696_003079 Ga0466696_003079_705_1637 310
74 3300042596 Ga0466696_008317 Ga0466696_008317_396_1328 310
75 3300042605 Ga0466716_223519 Ga0466716_223519_176_1108 310
76 3300042607 Ga0466720_025462 Ga0466720_025462_247_1179 310
77 3300042607 Ga0466720_217205 Ga0466720_217205_20311_21243 310
78 3300042609 Ga0466722_024613 Ga0466722_024613_178_1110 310
79 3300042609 Ga0466722_083389 Ga0466722_083389_2725_3657 310
80 3300042609 Ga0466722_262965 Ga0466722_262965_587_1519 310
81 3300042610 Ga0466698_140163 Ga0466698_140163_293_1225 310
82 3300042610 Ga0466698_438750 Ga0466698_438750_71_1003 310
83 3300042612 Ga0466705_445340 Ga0466705_445340_9907_10839 310
84 3300042615 Ga0466711_280934 Ga0466711_280934_4869_5801 310
85 3300042615 Ga0466711_433051 Ga0466711_433051_647_1579 310
86 3300042616 Ga0466715_121188 Ga0466715_121188_1040_1972 310
87 3300042617 Ga0466718_000859 Ga0466718_000859_908_1840 310
88 3300042617 Ga0466718_096241 Ga0466718_096241_2293_3225 310
89 3300042618 Ga0466723_017694 Ga0466723_017694_1744_2676 310
90 3300042624 Ga0466735_075003 Ga0466735_075003_140_1072 310
91 3300042636 Ga0466703_032402 Ga0466703_032402_2749_3681 310
92 3300042643 Ga0466704_137630 Ga0466704_137630_32387_33319 310
93 3300042652 Ga0466708_102916 Ga0466708_102916_1062_1994 310
94 3300042652 Ga0466708_132822 Ga0466708_132822_1605_2537 310
95 3300042652 Ga0466708_295739 Ga0466708_295739_1092_2024 310
96 3300042656 Ga0466732_104607 Ga0466732_104607_415_1347 310
97 3300042659 Ga0466733_172442 Ga0466733_172442_44_976 310
98 iso_pr_bacteria 2515154047 2515333595 310
99 iso_pr_bacteria 2515154047 2515333598 310
100 iso_pr_bacteria 2684622923 2686095915 310
101 iso_pr_bacteria 2684622924 2686098857 310
102 iso_pr_bacteria 2684622925 2686101194 310
103 iso_pr_bacteria 2684622926 2686104513 310
104 iso_pr_bacteria 2756170265 2756752763 310
105 iso_pr_bacteria 2781125630 2781267022 310
106 iso_pr_bacteria 2837615801 2837617510 310
107 iso_pr_bacteria 2837618715 2837620849 310
108 iso_pr_bacteria 2838840603 2838840973 310
109 iso_pr_bacteria 2841195917 2841196251 310
110 iso_pr_bacteria 2843334863 2843337401 310
111 iso_pr_bacteria 2846472545 2846473384 310
112 iso_pr_bacteria 2846475167 2846476914 310
113 iso_pr_bacteria 2846490831 2846492068 310
114 iso_pr_bacteria 2846495668 2846496846 310
115 iso_pr_bacteria 2849452216 2849453045 310
116 iso_pr_bacteria 2849463436 2849464194 310
117 iso_pr_bacteria 2854141978 2854143337 310
118 iso_pr_bacteria 2857870431 2857871209 310
119 iso_pr_bacteria 2857883421 2857884822 310
120 iso_pr_bacteria 2868486652 2868486762 310
121 iso_pr_bacteria 2868489326 2868489608 310
122 iso_pr_bacteria 2870897478 2870899902 310
123 iso_pr_bacteria 2873656248 2873658683 310
124 iso_pr_bacteria 2876016455 2876017523 310
125 iso_pr_bacteria 2876019154 2876021055 310
126 iso_pr_bacteria 2876022486 2876025137 310
127 iso_pr_bacteria 8088486376 8088488026 310
128 iso_pr_bacteria 8088491222 8088492957 310
129 iso_pr_bacteria 8088493931 8088495545 310
130 3300000333 HBC_ctgsDRAFT_1004230 HBC_ctgsDRAFT_10042301 311
131 3300000333 HBC_ctgsDRAFT_1004513 HBC_ctgsDRAFT_10045134 311
132 3300000473 SCG598I20_12783 SCG598I20_1278323 311
133 3300000490 SCG598L16_115148 SCG598L16_1151486 311
134 3300002449 JGI24698J34947_10003555 JGI24698J34947_100035554 311
135 3300002449 JGI24698J34947_10043139 JGI24698J34947_100431392 311
136 3300005485 Ga0074263_115093 Ga0074263_1150933 311
137 3300005721 Ga0074278_102689 Ga0074278_1026899 311
138 3300005721 Ga0074278_116492 Ga0074278_1164927 311
139 3300005721 Ga0074278_127329 Ga0074278_1273295 311
140 iso_pr_bacteria 2781125661 2781334143 311
141 iso_pr_bacteria 2781125682 2781409813 311
142 iso_pr_bacteria 2820013017 2820013484 311
143 3300002450 JGI24695J34938_10027030 JGI24695J34938_100270301 312
144 3300002450 JGI24695J34938_10044420 JGI24695J34938_100444201 312
145 3300042591 Ga0466692_164470 Ga0466692_164470_208_1146 312
146 3300042596 Ga0466696_375808 Ga0466696_375808_1858_2796 312
147 3300042602 Ga0466713_065914 Ga0466713_065914_6260_7198 312
148 3300042602 Ga0466713_070548 Ga0466713_070548_858_1796 312
149 3300042602 Ga0466713_079548 Ga0466713_079548_153_1091 312
150 3300042607 Ga0466720_079266 Ga0466720_079266_4670_5608 312
151 3300042612 Ga0466705_340718 Ga0466705_340718_166_1104 312
152 3300042612 Ga0466705_471587 Ga0466705_471587_5469_6407 312
153 3300042643 Ga0466704_235607 Ga0466704_235607_7288_8226 312
154 3300000062 IMNBL1DRAFT_c0008659 IMNBL1DRAFT_00086593 313
155 3300042601 Ga0466707_189775 Ga0466707_189775_28_969 313
156 3300042648 Ga0466709_397457 Ga0466709_397457_7531_8472 313
157 iso_pr_bacteria 2590828841 2593260622 313
158 iso_pr_bacteria 2820507989 2820509454 313
159 3300002450 JGI24695J34938_10039437 JGI24695J34938_100394371 314
160 3300005083 Ga0068305_10758694 Ga0068305_107586941 314
161 3300042599 Ga0466706_029872 Ga0466706_029872_3508_4452 314
162 3300042602 Ga0466713_003122 Ga0466713_003122_17_961 314
163 3300042612 Ga0466705_100765 Ga0466705_100765_18862_19806 314
164 3300042617 Ga0466718_104496 Ga0466718_104496_56_1000 314
165 3300042617 Ga0466718_116322 Ga0466718_116322_350_1294 314
166 3300042617 Ga0466718_162941 Ga0466718_162941_805_1749 314
167 3300042624 Ga0466735_164788 Ga0466735_164788_194_1138 314
168 iso_pr_bacteria 2585428085 2587836877 314
169 iso_pr_bacteria 2781125650 2781308074 314
170 3300002450 JGI24695J34938_10013658 JGI24695J34938_100136584 315
171 3300002462 JGI24702J35022_10076375 JGI24702J35022_100763751 315
172 3300042596 Ga0466696_213173 Ga0466696_213173_5690_6637 315
173 3300042599 Ga0466706_166171 Ga0466706_166171_1116_2063 315
174 3300042619 Ga0466726_114007 Ga0466726_114007_613_1560 315
175 3300042620 Ga0466728_313732 Ga0466728_313732_217_1164 315
176 3300042655 Ga0466727_245296 Ga0466727_245296_372_1319 315
177 iso_pr_bacteria 2820666966 2820668879 315
178 3300002450 JGI24695J34938_10000610 JGI24695J34938_1000061014 316
179 3300002509 JGI24699J35502_11133779 JGI24699J35502_111337798 316
180 3300042593 Ga0466691_029356 Ga0466691_029356_138_1088 316
181 3300042601 Ga0466707_012858 Ga0466707_012858_7289_8239 316
182 3300042643 Ga0466704_118713 Ga0466704_118713_2736_3686 316
183 iso_pr_bacteria 2820277137 2820279521 316
184 3300010167 Ga0123353_10781155 Ga0123353_107811552 317
185 3300042619 Ga0466726_208665 Ga0466726_208665_221_1174 317
186 3300042605 Ga0466716_251154 Ga0466716_251154_895_1851 318
187 3300042636 Ga0466703_397811 Ga0466703_397811_46561_47517 318
188 3300042654 Ga0466725_196961 Ga0466725_196961_9245_10201 318
189 3300042615 Ga0466711_369364 Ga0466711_369364_739_1698 319
190 3300042620 Ga0466728_022521 Ga0466728_022521_399_1358 319
191 3300042643 Ga0466704_498154 Ga0466704_498154_1887_2846 319
192 3300042600 Ga0466700_362509 Ga0466700_362509_94573_95535 320
193 3300042624 Ga0466735_133856 Ga0466735_133856_150_1112 320
194 3300042655 Ga0466727_031091 Ga0466727_031091_139_1104 321
195 3300042616 Ga0466715_512819 Ga0466715_512819_8923_9891 322
196 3300042619 Ga0466726_017517 Ga0466726_017517_1323_2291 322
197 3300042619 Ga0466726_208889 Ga0466726_208889_3185_4153 322
198 3300042655 Ga0466727_051845 Ga0466727_051845_50_1018 322
199 3300042591 Ga0466692_093077 Ga0466692_093077_452_1423 323
200 3300042599 Ga0466706_078767 Ga0466706_078767_77_1060 327
201 3300002462 JGI24702J35022_10036923 JGI24702J35022_100369232 328
202 3300042599 Ga0466706_197231 Ga0466706_197231_237_1226 329
203 3300042592 Ga0466693_134287 Ga0466693_134287_153_1157 334
204 iso_pr_bacteria 2820762746 2820763224 334
205 3300042648 Ga0466709_084178 Ga0466709_084178_6865_7878 337
206 3300042618 Ga0466723_133564 Ga0466723_133564_244_1266 340
207 3300042619 Ga0466726_168696 Ga0466726_168696_538_1662 374

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF08902 DUF1848 Domain of unknown function (DUF1848) 66 327 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.