Protein Family IF08248

Metagenome Isolate
184 Members
57 Samples
175 Scaffolds
166.23 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_161620|Ga0466726_161620_1288_1857
Length
189 aa
Sequence
MKKQLKLYEHYKLKKRNIMKKIFLALGLLLGGFAFANAQKFALIDMEYLLKNIPSYETANEQLNQVSKKWQAEVDAKQTDIQNKYKNYQTEVVFLSEEMKTKRENEIVAAEKELQELRRKYFGSDGELFKKRESLIKPIQDEIYNAVKDVCDDKGYQLILDRASGNNIIFASPKIDISDDVLAKMGYSK

📊 Sample Types

Isolate 4.9%
Metagenome 95.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.7%
Kalotermitidae 25.5%
Unclassified 12.7%
Rhinotermitidae 7.3%
Termopsidae 7.3%
Passalidae 5.5%
Blattidae 3.6%
Armadillidiidae 1.8%
Hodotermitidae 1.8%
Drosophilidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 176
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
2 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
5 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
6 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
7 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
8 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
9 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
10 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
15 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
16 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
17 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
18 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
19 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
20 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
21 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
22 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
23 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
24 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
25 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
26 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
27 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
28 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
29 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
30 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
31 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
32 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
33 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
34 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
35 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
36 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
37 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
38 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
39 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
40 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
41 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
42 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
43 3300005299 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 1 gut Metagenome Drosophilidae
44 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
45 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
46 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
47 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
48 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
49 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
50 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
51 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
52 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
53 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
54 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
55 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
56 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
57 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_380103 3300042612 Bacteria 6303
2 Ga0466733_098937 3300042659 Bacteria 150442
3 Ga0466700_058504 3300042600 Bacteria 32871
4 Ga0466707_149125 3300042601 Bacteria 54451
5 Ga0466707_241108 3300042601 Bacteria 10272
6 Ga0466713_077002 3300042602 Unclassified 1408
7 Ga0466722_245984 3300042609 Bacteria 2621
8 Ga0466690_158849 3300042590 Bacteria 3700
9 Ga0466690_185521 3300042590 Bacteria 30034
10 Ga0466690_216745 3300042590 Bacteria 23549
11 Ga0466692_118376 3300042591 Bacteria 10859
12 Ga0466692_156027 3300042591 Bacteria 99798
13 Ga0466723_001361 3300042618 Bacteria 10124
14 Ga0466729_099483 3300042621 Bacteria 41214
15 Ga0123357_10010391 3300009784 Bacteria 11836
16 Ga0123356_10008869 3300010049 Bacteria 9954
17 Ga0123356_10184502 3300010049 Bacteria 2111
18 Ga0123354_10006042 3300010882 Bacteria 17852
19 Ga0123354_10138272 3300010882 Bacteria 3031
20 Ga0466735_012596 3300042624 Bacteria 7500
21 Ga0466704_300754 3300042643 Bacteria 15840
22 Ga0466704_603581 3300042643 Bacteria 10476
23 Ga0466709_150615 3300042648 Bacteria 8322
24 Ga0466727_012286 3300042655 Unclassified 2177
25 Ga0466727_121999 3300042655 Bacteria 5144
26 IMNBL1DRAFT_c0001879 3300000062 Bacteria 15291
27 Ga0466705_043093 3300042612 Bacteria 9025
28 Ga0466714_033768 3300042603 Bacteria 2955
29 Ga0466716_132536 3300042605 Bacteria 38589
30 Ga0466690_266154 3300042590 Bacteria 16703
31 Ga0466694_386073 3300042594 Bacteria 3689
32 Ga0466696_128148 3300042596 Bacteria 1184
33 Ga0466715_539081 3300042616 Bacteria 22352
34 Ga0123355_10400538 3300009826 Bacteria 1770
35 Ga0123354_10044772 3300010882 Bacteria 6782
36 Ga0466735_007012 3300042624 Bacteria 9749
37 Ga0466735_022093 3300042624 Bacteria 1416
38 Ga0466703_007779 3300042636 Bacteria 9718
39 Ga0466704_141798 3300042643 Bacteria 1717
40 Ga0466704_228411 3300042643 Bacteria 3890
41 Ga0466708_172971 3300042652 Bacteria 8554
42 2227654075 2225789004 Bacteria 1986
43 IMNBL1DRAFT_c0025043 3300000062 Bacteria 2296
44 IMNBL1DRAFT_c0047033 3300000062 Bacteria 1396
45 JGI24696J40584_12953827 3300002834 Bacteria 2541
46 Ga0466707_184611 3300042601 Bacteria 10575
47 Ga0466714_075340 3300042603 Bacteria 5032
48 Ga0466716_064575 3300042605 Bacteria 8545
49 Ga0466719_562841 3300042606 Bacteria 1297
50 Ga0466697_039481 3300042611 Bacteria 2926
51 Ga0265387_1013054 3300024582 Bacteria 1156
52 Ga0466692_061204 3300042591 Bacteria 5151
53 Ga0466692_186666 3300042591 Unclassified 1941
54 Ga0466711_236714 3300042615 Bacteria 18403
55 Ga0466726_161620 3300042619 Bacteria 2106
56 Ga0466730_050517 3300042625 Bacteria 2216
57 Ga0466703_095941 3300042636 Bacteria 10067
58 Ga0466704_377215 3300042643 Unclassified 18321
59 Ga0466709_309597 3300042648 Bacteria 40669
60 IMNBL1DRAFT_c0000975 3300000062 Bacteria 22090
61 JGI24702J35022_10075890 3300002462 Unclassified 1816
62 Ga0466705_179010 3300042612 Bacteria 13746
63 Ga0466733_027547 3300042659 Bacteria 4185
64 Ga0466733_100739 3300042659 Bacteria 15317
65 Ga0466707_125055 3300042601 Bacteria 48281
66 Ga0466707_149294 3300042601 Bacteria 10479
67 Ga0466707_371061 3300042601 Bacteria 5489
68 Ga0466719_522466 3300042606 Bacteria 12904
69 Ga0466711_109799 3300042615 Bacteria 7548
70 Ga0466726_241947 3300042619 Bacteria 2444
71 Ga0466729_183964 3300042621 Bacteria 7155
72 Ga0123357_10003925 3300009784 Bacteria 17272
73 Ga0123357_10188816 3300009784 Bacteria 2382
74 Ga0123356_11487719 3300010049 Bacteria 835
75 Ga0123354_10023485 3300010882 Bacteria 9726
76 Ga0466729_298838 3300042621 Bacteria 9069
77 Ga0466704_106067 3300042643 Bacteria 5749
78 Ga0466708_348735 3300042652 Bacteria 36830
79 Ga0466727_182405 3300042655 Bacteria 2637
80 Ga0466727_332161 3300042655 Bacteria 6469
81 2227097468 2225789004 Bacteria 9705
82 2227100261 2225789004 Bacteria 9603
83 JGI24696J40584_12958305 3300002834 Bacteria 4024
84 Ga0466705_052121 3300042612 Bacteria 3996
85 Ga0466705_062816 3300042612 Bacteria 1476
86 Ga0466701_039977 3300042598 Bacteria 63641
87 Ga0466713_094780 3300042602 Bacteria 5332
88 Ga0466714_028666 3300042603 Bacteria 89946
89 Ga0466722_154451 3300042609 Bacteria 18589
90 Ga0160467_100079 3300012829 Bacteria 143692
91 Ga0466696_488820 3300042596 Bacteria 4509
92 Ga0466705_397833 3300042612 Bacteria 11678
93 Ga0466723_197989 3300042618 Bacteria 2277
94 Ga0466726_165433 3300042619 Bacteria 15218
95 Ga0123356_11232450 3300010049 Bacteria 913
96 Ga0466734_042351 3300042623 Bacteria 2098
97 Ga0466735_069773 3300042624 Bacteria 2591
98 Ga0466735_115958 3300042624 Bacteria 2820
99 Ga0466703_306816 3300042636 Bacteria 6824
100 Ga0466727_151598 3300042655 Bacteria 10939
101 IMNBL1DRAFT_c0008496 3300000062 Bacteria 5219
102 JGI24699J35502_11134117 3300002509 Bacteria 33021
103 Ga0074146_1080796 3300005299 Bacteria 626
104 Ga0466705_219816 3300042612 Bacteria 11106
105 Ga0466732_050860 3300042656 Bacteria 1920
106 Ga0466733_109595 3300042659 Bacteria 8758
107 Ga0466701_055721 3300042598 Bacteria 17089
108 Ga0466707_065865 3300042601 Bacteria 3433
109 Ga0466714_168628 3300042603 Bacteria 36223
110 Ga0466719_527620 3300042606 Bacteria 3348
111 Ga0466722_148018 3300042609 Bacteria 2619
112 Ga0466691_115668 3300042593 Bacteria 14219
113 Ga0466696_194073 3300042596 Bacteria 13847
114 Ga0466715_234297 3300042616 Bacteria 23273
115 Ga0466715_612327 3300042616 Bacteria 14168
116 Ga0466726_345273 3300042619 Bacteria 17044
117 Ga0123356_10600717 3300010049 Bacteria 1265
118 Ga0123354_10000458 3300010882 Bacteria 40359
119 Ga0466734_100783 3300042623 Bacteria 1216
120 Ga0466735_026200 3300042624 Bacteria 2932
121 Ga0466703_055226 3300042636 Bacteria 7202
122 Ga0466703_186435 3300042636 Bacteria 25415
123 Ga0466704_098030 3300042643 Bacteria 25866
124 Ga0466704_402414 3300042643 Bacteria 1312
125 Ga0466727_235389 3300042655 Bacteria 27915
126 2227419713 2225789004 Bacteria 5629
127 IMNBL1DRAFT_c0000748 3300000062 Bacteria 25790
128 IMNBL1DRAFT_c0023137 3300000062 Unclassified 2442
129 Ga0466705_000434 3300042612 Bacteria 1166
130 Ga0466733_054986 3300042659 Bacteria 147644
131 Ga0466707_120817 3300042601 Bacteria 29196
132 Ga0466707_402853 3300042601 Bacteria 16448
133 Ga0466713_066392 3300042602 Bacteria 2747
134 Ga0466713_120444 3300042602 Bacteria 5013
135 Ga0466716_467442 3300042605 Bacteria 25909
136 Ga0466657_388158 3300042582 Bacteria 5462
137 Ga0466692_157293 3300042591 Bacteria 55644
138 Ga0466715_117755 3300042616 Bacteria 4378
139 Ga0466729_185342 3300042621 Bacteria 1125
140 Ga0123357_10463225 3300009784 Bacteria 1087
141 Ga0123356_11987261 3300010049 Bacteria 725
142 Ga0123356_12508332 3300010049 Bacteria 645
143 Ga0466703_123347 3300042636 Bacteria 1314
144 Ga0466703_216149 3300042636 Bacteria 1515
145 Ga0466703_266206 3300042636 Bacteria 2006
146 Ga0466704_186888 3300042643 Bacteria 12934
147 Ga0466727_294126 3300042655 Bacteria 6812
148 2227066924 2225789003 Bacteria 3164
149 IMNBL1DRAFT_c0003109 3300000062 Bacteria 10946
150 IMNBL1DRAFT_c0003820 3300000062 Bacteria 9388
151 IMNBL1DRAFT_c0006226 3300000062 Bacteria 6563
152 Ga0068302_10688297 3300005071 Bacteria 908
153 Ga0123357_10000375 3300009784 Bacteria 42298
154 Ga0466697_066145 3300042611 Bacteria 1098
155 Ga0466706_050770 3300042599 Bacteria 1617
156 Ga0466719_422128 3300042606 Bacteria 2704
157 Ga0466693_074215 3300042592 Bacteria 1612
158 Ga0466696_231342 3300042596 Bacteria 20663
159 Ga0466696_402623 3300042596 Bacteria 8383
160 Ga0466728_286887 3300042620 Bacteria 10655
161 Ga0123357_10029772 3300009784 Bacteria 7401
162 Ga0123354_10332095 3300010882 Unclassified 1384
163 Ga0123354_10373100 3300010882 Bacteria 1242
164 Ga0466730_043926 3300042625 Bacteria 5251
165 Ga0466703_261353 3300042636 Bacteria 5465
166 Ga0466704_444391 3300042643 Unclassified 2045
167 Ga0466704_482235 3300042643 Bacteria 12517
168 Ga0466709_316667 3300042648 Bacteria 8932
169 Ga0466727_030490 3300042655 Bacteria 13925
170 Ga0466727_154212 3300042655 Bacteria 9784
171 2227236340 2225789004 Bacteria 7303
172 2227250289 2225789004 Bacteria 1321
173 JGI24702J35022_10209388 3300002462 Bacteria 1119
174 JGI24696J40584_12959377 3300002834 Bacteria 5055
175 Ga0068302_10031740 3300005071 Bacteria 4999

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010049 Ga0123356_10184502 Ga0123356_101845023 150
2 3300042602 Ga0466713_094780 Ga0466713_094780_1546_2061 150
3 3300042624 Ga0466735_069773 Ga0466735_069773_1803_2318 150
4 3300042655 Ga0466727_121999 Ga0466727_121999_259_780 150
5 2225789004 2227097468 2227479306 151
6 3300009784 Ga0123357_10188816 Ga0123357_101888164 151
7 3300010882 Ga0123354_10000458 Ga0123354_1000045832 152
8 3300010882 Ga0123354_10023485 Ga0123354_100234859 152
9 3300010882 Ga0123354_10044772 Ga0123354_100447725 152
10 3300042591 Ga0466692_118376 Ga0466692_118376_3095_3619 152
11 3300042600 Ga0466700_058504 Ga0466700_058504_18577_19095 152
12 3300042602 Ga0466713_066392 Ga0466713_066392_1552_2067 152
13 3300042609 Ga0466722_245984 Ga0466722_245984_536_1051 152
14 3300000062 IMNBL1DRAFT_c0003109 IMNBL1DRAFT_00031094 153
15 3300042591 Ga0466692_186666 Ga0466692_186666_986_1498 153
16 3300042601 Ga0466707_402853 Ga0466707_402853_9787_10302 153
17 3300042606 Ga0466719_562841 Ga0466719_562841_759_1271 153
18 3300042616 Ga0466715_234297 Ga0466715_234297_1894_2409 153
19 3300042621 Ga0466729_185342 Ga0466729_185342_313_828 153
20 3300042624 Ga0466735_115958 Ga0466735_115958_1930_2451 153
21 3300042643 Ga0466704_186888 Ga0466704_186888_3665_4177 153
22 3300002509 JGI24699J35502_11134117 JGI24699J35502_1113411725 154
23 3300005299 Ga0074146_1080796 Ga0074146_10807961 154
24 3300042591 Ga0466692_061204 Ga0466692_061204_4171_4695 154
25 3300042601 Ga0466707_184611 Ga0466707_184611_8414_8938 154
26 3300042612 Ga0466705_397833 Ga0466705_397833_3632_4144 154
27 3300042625 Ga0466730_050517 Ga0466730_050517_733_1248 154
28 3300042652 Ga0466708_348735 Ga0466708_348735_2398_2916 154
29 3300009784 Ga0123357_10003925 Ga0123357_100039259 155
30 3300042606 Ga0466719_522466 Ga0466719_522466_5063_5578 155
31 3300042643 Ga0466704_377215 Ga0466704_377215_17561_18076 155
32 3300042655 Ga0466727_332161 Ga0466727_332161_5472_6011 155
33 3300000062 IMNBL1DRAFT_c0003820 IMNBL1DRAFT_00038205 156
34 3300042609 Ga0466722_154451 Ga0466722_154451_620_1090 156
35 3300042636 Ga0466703_216149 Ga0466703_216149_313_837 156
36 3300010049 Ga0123356_11987261 Ga0123356_119872611 157
37 3300042594 Ga0466694_386073 Ga0466694_386073_2388_2903 157
38 3300042643 Ga0466704_141798 Ga0466704_141798_1161_1682 157
39 3300042643 Ga0466704_444391 Ga0466704_444391_985_1500 157
40 3300000062 IMNBL1DRAFT_c0001879 IMNBL1DRAFT_00018798 158
41 3300000062 IMNBL1DRAFT_c0025043 IMNBL1DRAFT_00250434 158
42 3300010049 Ga0123356_10008869 Ga0123356_100088697 158
43 3300042601 Ga0466707_241108 Ga0466707_241108_3138_3614 158
44 3300042636 Ga0466703_007779 Ga0466703_007779_8837_9361 158
45 3300042643 Ga0466704_106067 Ga0466704_106067_2911_3426 158
46 3300042643 Ga0466704_300754 Ga0466704_300754_183_707 158
47 3300042659 Ga0466733_100739 Ga0466733_100739_717_1232 158
48 3300000062 IMNBL1DRAFT_c0008496 IMNBL1DRAFT_00084962 159
49 3300000062 IMNBL1DRAFT_c0047033 IMNBL1DRAFT_00470332 159
50 3300009784 Ga0123357_10029772 Ga0123357_100297724 159
51 3300042582 Ga0466657_388158 Ga0466657_388158_1620_2135 159
52 3300042648 Ga0466709_316667 Ga0466709_316667_5204_5725 159
53 3300042592 Ga0466693_074215 Ga0466693_074215_906_1430 160
54 3300042601 Ga0466707_149125 Ga0466707_149125_34973_35497 160
55 3300042602 Ga0466713_077002 Ga0466713_077002_642_1151 160
56 3300042612 Ga0466705_062816 Ga0466705_062816_861_1382 160
57 3300042620 Ga0466728_286887 Ga0466728_286887_7198_7719 160
58 3300042643 Ga0466704_402414 Ga0466704_402414_161_682 160
59 3300010882 Ga0123354_10006042 Ga0123354_100060429 161
60 3300042596 Ga0466696_402623 Ga0466696_402623_6815_7330 161
61 3300042605 Ga0466716_064575 Ga0466716_064575_5724_6263 161
62 3300042624 Ga0466735_026200 Ga0466735_026200_626_1141 161
63 3300042596 Ga0466696_231342 Ga0466696_231342_11485_12000 162
64 3300042601 Ga0466707_371061 Ga0466707_371061_4943_5458 162
65 3300042636 Ga0466703_095941 Ga0466703_095941_1210_1698 162
66 3300042636 Ga0466703_186435 Ga0466703_186435_19826_20338 162
67 3300005071 Ga0068302_10031740 Ga0068302_100317401 163
68 3300042590 Ga0466690_216745 Ga0466690_216745_8461_8955 164
69 3300042590 Ga0466690_266154 Ga0466690_266154_14028_14522 164
70 3300042596 Ga0466696_194073 Ga0466696_194073_2717_3238 164
71 3300042611 Ga0466697_066145 Ga0466697_066145_388_882 164
72 3300042612 Ga0466705_043093 Ga0466705_043093_4592_5086 164
73 3300042612 Ga0466705_179010 Ga0466705_179010_6394_6888 164
74 3300042616 Ga0466715_117755 Ga0466715_117755_2439_2933 164
75 3300042636 Ga0466703_266206 Ga0466703_266206_793_1287 164
76 3300042643 Ga0466704_482235 Ga0466704_482235_4803_5297 164
77 3300042655 Ga0466727_294126 Ga0466727_294126_6281_6775 164
78 3300042615 Ga0466711_236714 Ga0466711_236714_9060_9575 165
79 3300042648 Ga0466709_150615 Ga0466709_150615_6713_7231 165
80 3300042591 Ga0466692_156027 Ga0466692_156027_67444_68019 169
81 3300042655 Ga0466727_154212 Ga0466727_154212_4467_5039 169
82 3300000062 IMNBL1DRAFT_c0006226 IMNBL1DRAFT_00062262 170
83 3300042619 Ga0466726_165433 Ga0466726_165433_5740_6279 170
84 3300042636 Ga0466703_261353 Ga0466703_261353_1880_2392 170
85 3300042655 Ga0466727_235389 Ga0466727_235389_14347_14859 170
86 2225789003 2227066924 2227425379 171
87 2225789004 2227100261 2227483473 171
88 2225789004 2227236340 2227674103 171
89 2225789004 2227654075 2228251237 171
90 3300009826 Ga0123355_10400538 Ga0123355_104005382 171
91 3300024582 Ga0265387_1013054 Ga0265387_10130542 171
92 3300042590 Ga0466690_158849 Ga0466690_158849_3140_3655 171
93 3300042596 Ga0466696_128148 Ga0466696_128148_60_575 171
94 3300042598 Ga0466701_055721 Ga0466701_055721_11023_11538 171
95 3300042601 Ga0466707_120817 Ga0466707_120817_7952_8467 171
96 3300042601 Ga0466707_149294 Ga0466707_149294_2570_3085 171
97 3300042602 Ga0466713_120444 Ga0466713_120444_4043_4558 171
98 3300042603 Ga0466714_028666 Ga0466714_028666_11735_12250 171
99 3300042605 Ga0466716_132536 Ga0466716_132536_31865_32380 171
100 3300042606 Ga0466719_527620 Ga0466719_527620_2699_3214 171
101 3300042609 Ga0466722_148018 Ga0466722_148018_905_1420 171
102 3300042612 Ga0466705_052121 Ga0466705_052121_500_1015 171
103 3300042616 Ga0466715_539081 Ga0466715_539081_19558_20073 171
104 3300042616 Ga0466715_612327 Ga0466715_612327_2553_3068 171
105 3300042619 Ga0466726_345273 Ga0466726_345273_4121_4636 171
106 3300042621 Ga0466729_099483 Ga0466729_099483_38843_39358 171
107 3300042621 Ga0466729_298838 Ga0466729_298838_3224_3739 171
108 3300042624 Ga0466735_012596 Ga0466735_012596_2607_3122 171
109 3300042625 Ga0466730_043926 Ga0466730_043926_1639_2154 171
110 3300042655 Ga0466727_012286 Ga0466727_012286_1594_2109 171
111 3300042655 Ga0466727_030490 Ga0466727_030490_5328_5843 171
112 3300042656 Ga0466732_050860 Ga0466732_050860_755_1270 171
113 3300042659 Ga0466733_027547 Ga0466733_027547_2243_2758 171
114 3300042659 Ga0466733_054986 Ga0466733_054986_58770_59285 171
115 3300042659 Ga0466733_098937 Ga0466733_098937_52853_53368 171
116 iso_pr_bacteria 2695420931 2698110803 171
117 iso_pr_bacteria 2820759988 2820761521 171
118 iso_pr_bacteria 2820778767 2820780630 171
119 iso_pr_bacteria 2910959314 2910960223 171
120 iso_pr_bacteria 8100166142 8100169719 171
121 2225789004 2227250289 2227693316 172
122 2225789004 2227419713 2227861110 172
123 3300000062 IMNBL1DRAFT_c0000748 IMNBL1DRAFT_000074817 172
124 3300000062 IMNBL1DRAFT_c0000975 IMNBL1DRAFT_00009757 172
125 3300000062 IMNBL1DRAFT_c0023137 IMNBL1DRAFT_00231372 172
126 3300002834 JGI24696J40584_12953827 JGI24696J40584_129538271 172
127 3300002834 JGI24696J40584_12958305 JGI24696J40584_129583053 172
128 3300009784 Ga0123357_10000375 Ga0123357_1000037532 172
129 3300009784 Ga0123357_10010391 Ga0123357_100103915 172
130 3300009784 Ga0123357_10463225 Ga0123357_104632252 172
131 3300010049 Ga0123356_11232450 Ga0123356_112324501 172
132 3300010049 Ga0123356_12508332 Ga0123356_125083321 172
133 3300010882 Ga0123354_10138272 Ga0123354_101382722 172
134 3300010882 Ga0123354_10332095 Ga0123354_103320952 172
135 3300010882 Ga0123354_10373100 Ga0123354_103731002 172
136 3300012829 Ga0160467_100079 Ga0160467_100079108 172
137 3300042601 Ga0466707_065865 Ga0466707_065865_2154_2672 172
138 3300002462 JGI24702J35022_10075890 JGI24702J35022_100758902 173
139 3300002462 JGI24702J35022_10209388 JGI24702J35022_102093881 173
140 3300010049 Ga0123356_10600717 Ga0123356_106007172 173
141 3300010049 Ga0123356_11487719 Ga0123356_114877192 173
142 3300042603 Ga0466714_168628 Ga0466714_168628_12649_13170 173
143 3300042643 Ga0466704_098030 Ga0466704_098030_13978_14499 173
144 3300002834 JGI24696J40584_12959377 JGI24696J40584_129593773 174
145 3300042590 Ga0466690_185521 Ga0466690_185521_5627_6151 174
146 3300042591 Ga0466692_157293 Ga0466692_157293_48932_49456 174
147 3300042593 Ga0466691_115668 Ga0466691_115668_9536_10060 174
148 3300042596 Ga0466696_488820 Ga0466696_488820_893_1417 174
149 3300042598 Ga0466701_039977 Ga0466701_039977_146_670 174
150 3300042599 Ga0466706_050770 Ga0466706_050770_456_980 174
151 3300042601 Ga0466707_125055 Ga0466707_125055_23453_23977 174
152 3300042603 Ga0466714_033768 Ga0466714_033768_1901_2425 174
153 3300042605 Ga0466716_467442 Ga0466716_467442_11982_12506 174
154 3300042606 Ga0466719_422128 Ga0466719_422128_1417_1941 174
155 3300042612 Ga0466705_000434 Ga0466705_000434_569_1093 174
156 3300042612 Ga0466705_219816 Ga0466705_219816_2414_2938 174
157 3300042612 Ga0466705_380103 Ga0466705_380103_1226_1750 174
158 3300042615 Ga0466711_109799 Ga0466711_109799_48_572 174
159 3300042618 Ga0466723_001361 Ga0466723_001361_8180_8704 174
160 3300042618 Ga0466723_197989 Ga0466723_197989_1085_1609 174
161 3300042619 Ga0466726_241947 Ga0466726_241947_1366_1890 174
162 3300042621 Ga0466729_183964 Ga0466729_183964_5124_5648 174
163 3300042623 Ga0466734_042351 Ga0466734_042351_299_823 174
164 3300042623 Ga0466734_100783 Ga0466734_100783_451_975 174
165 3300042624 Ga0466735_007012 Ga0466735_007012_3963_4487 174
166 3300042636 Ga0466703_055226 Ga0466703_055226_2817_3341 174
167 3300042636 Ga0466703_123347 Ga0466703_123347_229_753 174
168 3300042636 Ga0466703_306816 Ga0466703_306816_5557_6081 174
169 3300042643 Ga0466704_228411 Ga0466704_228411_1154_1678 174
170 3300042643 Ga0466704_603581 Ga0466704_603581_2036_2560 174
171 3300042648 Ga0466709_309597 Ga0466709_309597_8808_9332 174
172 3300042652 Ga0466708_172971 Ga0466708_172971_2804_3328 174
173 3300042655 Ga0466727_182405 Ga0466727_182405_1479_2003 174
174 iso_pr_bacteria 2820762746 2820764081 174
175 iso_pr_bacteria 2940216256 2940218275 174
176 iso_pr_bacteria 2967483437 2967484061 174
177 3300005071 Ga0068302_10688297 Ga0068302_106882971 175
178 3300042655 Ga0466727_151598 Ga0466727_151598_2644_3207 175
179 3300042624 Ga0466735_022093 Ga0466735_022093_379_1017 178
180 3300042603 Ga0466714_075340 Ga0466714_075340_1810_2349 179
181 3300042659 Ga0466733_109595 Ga0466733_109595_5900_6439 179
182 3300042611 Ga0466697_039481 Ga0466697_039481_649_1227 187
183 3300042619 Ga0466726_161620 Ga0466726_161620_1288_1857 189
184 iso_pr_bacteria 2718218155 2720328371 189

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03938 OmpH Outer membrane protein (OmpH-like) 40 185 0.94

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF03938 GO:0051082 unfolded protein binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.69 0.79 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.