Protein Family IF08244

Metagenome Isolate
158 Members
78 Samples
135 Scaffolds
461.01 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_151678|Ga0466726_151678_622_2157
Length
511 aa
Sequence
LQQRHKTLIYYFNNFKKTTNMKVKQSMTRRNFLATSGAALVGSVLINPASELRAATAVTSPRQAKDGLKLAMVGTGSRGTSMWGRGLTERYPEIKFVGLCDSNPGRVEAGREIIGANCPTYSDLKNPMAAFEKMIAETKPDMLVVTTVDATHNEYIVRGMELGVNVLTEKPMTTDEAKVQQILDAEKRTGRKTRVTFNYRYSPHRAKIWELLRAGEIGELTSVDFHWYLDTRHGADYFRRWHRLVEKSGSLWVHKASHHFDLLNWWIDSDPETVYALGSLDFYGKNGTYRAENCRTCPHTQTCPFYFQLDRPIMSAAMQDAAGVNRQAAFVNPYKRLYIDCEQHDGYLRDGCVFKNDINIFDKMAATIKYANGVQVAYSLTAYSPYEGYRIAFNGTKGRLDAWIQESNPMQDRDYDEIVLFKNFSRRQYIQIPYGTSGHGGGDDLLRDQIFIPGTPDPLKQCAGTRDGAFACLIGIAARNSIASAQPVKIADLTSLRPQAQKEYQRDIMGM

📊 Sample Types

Isolate 14.6%
Metagenome 85.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 27.0%
Blattidae 25.7%
Kalotermitidae 18.9%
Armadillidiidae 5.4%
Rhinotermitidae 5.4%
Termopsidae 5.4%
Unclassified 4.1%
Passalidae 2.7%
Daphniidae 1.4%
Culicidae 1.4%
Drosophilidae 1.4%
Scarabaeidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 153
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
4 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
5 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
6 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
7 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
8 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
9 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
10 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
11 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
12 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
13 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
14 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
15 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
16 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
17 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
18 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
19 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
20 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
22 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
23 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
24 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
25 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
26 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
27 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
28 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
29 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
30 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
31 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
32 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
33 3004672520 Bacteroides sp. 51 Isolate Blattidae
34 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
35 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
36 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
37 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
38 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
39 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
40 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
41 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
42 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
43 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
44 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
45 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
46 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
47 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
48 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
49 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
50 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
51 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
52 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
53 2508501067 Opitutaceae bacterium TAV1 Isolate Unclassified
54 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
55 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
56 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
57 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
58 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
59 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
60 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
61 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
62 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
63 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
64 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
65 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
66 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
67 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
68 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
69 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
70 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
71 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
72 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
73 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
74 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
75 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
76 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
77 3004677695 Bacteroides sp. 214 Isolate Blattidae
78 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_201662 3300042612 Bacteria 6224
2 Ga0466733_183414 3300042659 Bacteria 71919
3 Ga0123356_10055686 3300010049 Bacteria 3684
4 Ga0123353_10494356 3300010167 Bacteria 1785
5 Ga0466703_079251 3300042636 Bacteria 4119
6 Ga0466704_150943 3300042643 Bacteria 32243
7 Ga0466704_505246 3300042643 Bacteria 9861
8 Ga0466725_359981 3300042654 Bacteria 5122
9 Ga0466715_074218 3300042616 Bacteria 18263
10 Ga0466726_307227 3300042619 Bacteria 8546
11 Ga0466728_361802 3300042620 Bacteria 2750
12 Ga0265387_1002894 3300024582 Bacteria 2401
13 Ga0265387_1007015 3300024582 Bacteria 1511
14 Ga0466657_389886 3300042582 Bacteria 3677
15 Ga0466691_101293 3300042593 Bacteria 13506
16 Ga0466701_026085 3300042598 Bacteria 5920
17 Ga0466707_022979 3300042601 Bacteria 9879
18 Ga0466707_225866 3300042601 Bacteria 5232
19 Ga0466714_033894 3300042603 Bacteria 61713
20 Ga0466716_484837 3300042605 Bacteria 30730
21 Ga0466719_177993 3300042606 Bacteria 4055
22 Ga0466719_323893 3300042606 Bacteria 3147
23 Ga0466719_454950 3300042606 Bacteria 2008
24 JGI24705J35276_12238552 3300002504 Bacteria 26267
25 Ga0072941_1020973 3300005201 Bacteria 68603
26 Ga0466705_286980 3300042612 Bacteria 27218
27 Ga0466733_217303 3300042659 Bacteria 2282
28 Ga0123353_10060772 3300010167 Bacteria 6059
29 Ga0466709_020733 3300042648 Bacteria 48670
30 Ga0466708_149614 3300042652 Bacteria 33318
31 Ga0466715_038341 3300042616 Bacteria 16679
32 Ga0466715_065052 3300042616 Bacteria 1717
33 Ga0466715_286685 3300042616 Bacteria 27433
34 Ga0466726_151678 3300042619 Bacteria 3147
35 Ga0466728_454354 3300042620 Bacteria 18234
36 Ga0160445_101833 3300012847 Bacteria 5471
37 Ga0466690_402356 3300042590 Bacteria 64397
38 Ga0466719_298493 3300042606 Bacteria 1556
39 Ga0466697_186481 3300042611 Bacteria 27325
40 Ga0123354_10082162 3300010882 Bacteria 4544
41 Ga0466735_008353 3300042624 Bacteria 1797
42 Ga0466704_119635 3300042643 Bacteria 13895
43 Ga0466711_342049 3300042615 Bacteria 11183
44 Ga0160452_100344 3300012834 Bacteria 39822
45 Ga0466693_136038 3300042592 Bacteria 1273
46 Ga0466701_072680 3300042598 Bacteria 34156
47 Ga0466722_039133 3300042609 Bacteria 10795
48 Ga0466722_173318 3300042609 Bacteria 10485
49 JGI24699J35502_11133800 3300002509 Bacteria 15831
50 JGI24696J40584_12958454 3300002834 Bacteria 4153
51 Ga0466697_165305 3300042611 Bacteria 1440
52 Ga0123353_10363541 3300010167 Bacteria 2173
53 Ga0466735_128473 3300042624 Bacteria 3633
54 Ga0466704_155985 3300042643 Unclassified 13710
55 Ga0466704_575886 3300042643 Bacteria 3625
56 Ga0466709_066569 3300042648 Bacteria 14891
57 Ga0466727_252848 3300042655 Bacteria 2103
58 Ga0466715_006176 3300042616 Bacteria 25661
59 Ga0160433_100166 3300012846 Bacteria 55536
60 Ga0466656_042995 3300042550 Bacteria 2121
61 Ga0466656_203770 3300042550 Unclassified 2775
62 Ga0466690_341657 3300042590 Bacteria 12470
63 Ga0466691_039152 3300042593 Bacteria 2878
64 Ga0466696_058652 3300042596 Bacteria 8803
65 Ga0466696_431143 3300042596 Bacteria 6543
66 Ga0466717_069287 3300042604 Bacteria 2455
67 2227581849 2225789004 Bacteria 2503
68 2227601855 2225789004 Bacteria 2330
69 IMNBL1DRAFT_c0000127 3300000062 Bacteria 67907
70 JGI24702J35022_10007701 3300002462 Bacteria 6150
71 Ga0466705_261600 3300042612 Bacteria 9653
72 Ga0123354_10208188 3300010882 Bacteria 2124
73 Ga0160470_100059 3300012813 Bacteria 159194
74 Ga0466735_008785 3300042624 Bacteria 7437
75 Ga0466703_191485 3300042636 Bacteria 7980
76 Ga0466704_450967 3300042643 Bacteria 8239
77 Ga0466725_165576 3300042654 Bacteria 35468
78 Ga0466718_112585 3300042617 Bacteria 2635
79 Ga0466690_218264 3300042590 Bacteria 18957
80 Ga0466693_245962 3300042592 Unclassified 5453
81 Ga0466694_354079 3300042594 Bacteria 2226
82 Ga0466701_080415 3300042598 Bacteria 4287
83 Ga0466716_376714 3300042605 Bacteria 8728
84 Ga0466697_238690 3300042611 Bacteria 1969
85 Ga0466733_192917 3300042659 Bacteria 71960
86 Ga0160466_100795 3300012809 Bacteria 12273
87 Ga0466734_039167 3300042623 Bacteria 2871
88 Ga0466708_129066 3300042652 Bacteria 5993
89 Ga0466708_208740 3300042652 Bacteria 4905
90 Ga0466711_458035 3300042615 Bacteria 14701
91 Ga0466715_015236 3300042616 Bacteria 24756
92 Ga0466723_029164 3300042618 Bacteria 16365
93 Ga0466728_008122 3300042620 Bacteria 3841
94 Ga0160468_100160 3300012819 Bacteria 53120
95 Ga0466690_085973 3300042590 Bacteria 8307
96 Ga0466692_161211 3300042591 Bacteria 49415
97 Ga0466713_044941 3300042602 Bacteria 1976
98 2227652413 2225789004 Bacteria 10718
99 JGI24702J35022_10020751 3300002462 Bacteria 3563
100 JGI24702J35022_10053439 3300002462 Unclassified 2154
101 Ga0466705_110830 3300042612 Bacteria 8898
102 Ga0466733_215275 3300042659 Bacteria 11360
103 Ga0123353_10038277 3300010167 Bacteria 7537
104 Ga0466731_270234 3300042622 Bacteria 2094
105 Ga0466703_262761 3300042636 Bacteria 4585
106 Ga0466704_222943 3300042643 Bacteria 11416
107 Ga0466708_072141 3300042652 Bacteria 7571
108 Ga0466708_254262 3300042652 Bacteria 30960
109 Ga0466727_290618 3300042655 Bacteria 84490
110 Ga0466711_178173 3300042615 Bacteria 4517
111 Ga0466711_404115 3300042615 Bacteria 44506
112 Ga0466715_008279 3300042616 Bacteria 34287
113 Ga0466729_091329 3300042621 Bacteria 4338
114 Ga0466713_118877 3300042602 Bacteria 3348
115 Ga0466714_032700 3300042603 Bacteria 6303
116 IMNBL1DRAFT_c0005132 3300000062 Bacteria 7610
117 Ga0068302_10215373 3300005071 Bacteria 3579
118 Ga0072941_1201102 3300005201 Bacteria 2151
119 Ga0466705_032077 3300042612 Bacteria 35827
120 Ga0123353_10266112 3300010167 Bacteria 2645
121 Ga0466704_222113 3300042643 Bacteria 2352
122 Ga0466709_145891 3300042648 Bacteria 8479
123 Ga0466715_455126 3300042616 Bacteria 17407
124 Ga0466715_470418 3300042616 Bacteria 18054
125 Ga0466726_214397 3300042619 Bacteria 3117
126 Ga0466728_030334 3300042620 Bacteria 9746
127 Ga0160467_100796 3300012829 Bacteria 21233
128 Ga0466692_115633 3300042591 Bacteria 15537
129 Ga0466696_005686 3300042596 Bacteria 4170
130 Ga0466707_089281 3300042601 Bacteria 15760
131 Ga0466722_084946 3300042609 Bacteria 11980
132 JGI24702J35022_10010809 3300002462 Bacteria 5093
133 JGI24702J35022_10012058 3300002462 Bacteria 4812
134 Ga0068302_10061352 3300005071 Unclassified 5292
135 Ga0105005_1018018 3300007505 Bacteria 2912

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042592 Ga0466693_136038 Ga0466693_136038_59_1261 400
2 3300042616 Ga0466715_470418 Ga0466715_470418_341_1546 401
3 3300042615 Ga0466711_342049 Ga0466711_342049_2590_3798 402
4 3300042616 Ga0466715_286685 Ga0466715_286685_88_1296 402
5 3300042624 Ga0466735_008353 Ga0466735_008353_55_1263 402
6 3300042593 Ga0466691_039152 Ga0466691_039152_1612_2850 412
7 3300042550 Ga0466656_042995 Ga0466656_042995_134_1387 417
8 3300042616 Ga0466715_065052 Ga0466715_065052_412_1707 423
9 3300042643 Ga0466704_222943 Ga0466704_222943_5531_6811 426
10 3300042623 Ga0466734_039167 Ga0466734_039167_1567_2850 427
11 iso_pr_bacteria 2585428141 2588053347 428
12 3300000062 IMNBL1DRAFT_c0000127 IMNBL1DRAFT_000012747 429
13 3300005201 Ga0072941_1020973 Ga0072941_102097319 429
14 3300012829 Ga0160467_100796 Ga0160467_10079613 430
15 3300042606 Ga0466719_298493 Ga0466719_298493_35_1327 430
16 iso_pr_bacteria 2852337885 2852340007 430
17 3300012809 Ga0160466_100795 Ga0160466_1007955 431
18 3300012819 Ga0160468_100160 Ga0160468_1001603 432
19 3300012834 Ga0160452_100344 Ga0160452_10034444 432
20 3300012847 Ga0160445_101833 Ga0160445_1018332 432
21 3300042636 Ga0466703_079251 Ga0466703_079251_2578_3876 432
22 3300042612 Ga0466705_261600 Ga0466705_261600_5566_6966 437
23 3300007505 Ga0105005_1018018 Ga0105005_10180182 439
24 3300012846 Ga0160433_100166 Ga0160433_1001663 439
25 3300042652 Ga0466708_072141 Ga0466708_072141_3014_4333 439
26 3300042592 Ga0466693_245962 Ga0466693_245962_326_1648 440
27 3300002834 JGI24696J40584_12958454 JGI24696J40584_129584543 441
28 3300042605 Ga0466716_376714 Ga0466716_376714_4805_6163 441
29 3300042652 Ga0466708_149614 Ga0466708_149614_13969_15297 442
30 iso_pr_bacteria 2508501067 2508838483 443
31 iso_pr_bacteria 2590828803 2592929460 444
32 3300012813 Ga0160470_100059 Ga0160470_100059102 445
33 3300042611 Ga0466697_165305 Ga0466697_165305_10_1347 445
34 3300042616 Ga0466715_074218 Ga0466715_074218_3147_4697 447
35 3300042601 Ga0466707_225866 Ga0466707_225866_882_2261 448
36 3300042602 Ga0466713_118877 Ga0466713_118877_281_1633 450
37 3300042659 Ga0466733_217303 Ga0466733_217303_698_2053 451
38 3300042619 Ga0466726_214397 Ga0466726_214397_372_1730 452
39 3300042643 Ga0466704_450967 Ga0466704_450967_3724_5082 452
40 3300042648 Ga0466709_066569 Ga0466709_066569_6209_7567 452
41 3300042652 Ga0466708_208740 Ga0466708_208740_1377_2735 452
42 iso_pr_bacteria 3004677695 3004679608 452
43 3300042590 Ga0466690_218264 Ga0466690_218264_407_1768 453
44 3300042598 Ga0466701_072680 Ga0466701_072680_23412_24773 453
45 3300042616 Ga0466715_038341 Ga0466715_038341_2146_3507 453
46 3300042620 Ga0466728_361802 Ga0466728_361802_436_1803 455
47 iso_pr_bacteria 2940205530 2940205962 455
48 iso_pr_bacteria 2940212447 2940212877 455
49 iso_pr_bacteria 2940298504 2940298934 455
50 iso_pr_bacteria 2940302308 2940302994 455
51 iso_pr_bacteria 2940306115 2940306404 455
52 iso_pr_bacteria 2940309933 2940309965 455
53 iso_pr_bacteria 2940313741 2940313773 455
54 iso_pr_bacteria 2940317558 2940317845 455
55 iso_pr_bacteria 2940321370 2940321402 455
56 iso_pr_bacteria 2940325180 2940325866 455
57 iso_pr_bacteria 2940328985 2940329672 455
58 iso_pr_bacteria 2940332795 2940333084 455
59 iso_pr_bacteria 3004672520 3004675370 455
60 3300042591 Ga0466692_161211 Ga0466692_161211_11903_13273 456
61 3300042601 Ga0466707_089281 Ga0466707_089281_12011_13381 456
62 3300042603 Ga0466714_033894 Ga0466714_033894_35561_36931 456
63 3300042606 Ga0466719_454950 Ga0466719_454950_20_1390 456
64 3300042609 Ga0466722_084946 Ga0466722_084946_10060_11430 456
65 3300042603 Ga0466714_032700 Ga0466714_032700_1233_2606 457
66 3300042590 Ga0466690_402356 Ga0466690_402356_6963_8339 458
67 3300042596 Ga0466696_058652 Ga0466696_058652_6312_7688 458
68 3300042596 Ga0466696_431143 Ga0466696_431143_545_1921 458
69 3300042612 Ga0466705_201662 Ga0466705_201662_4393_5769 458
70 3300042620 Ga0466728_454354 Ga0466728_454354_9803_11179 458
71 3300042636 Ga0466703_262761 Ga0466703_262761_557_1933 458
72 3300042643 Ga0466704_150943 Ga0466704_150943_1962_3338 458
73 3300042643 Ga0466704_575886 Ga0466704_575886_1142_2518 458
74 3300024582 Ga0265387_1002894 Ga0265387_10028941 459
75 3300042602 Ga0466713_044941 Ga0466713_044941_252_1631 459
76 3300042612 Ga0466705_032077 Ga0466705_032077_27844_29223 459
77 3300042612 Ga0466705_286980 Ga0466705_286980_7192_8571 459
78 3300042643 Ga0466704_505246 Ga0466704_505246_2284_3663 459
79 3300042655 Ga0466727_252848 Ga0466727_252848_558_1937 459
80 2225789004 2227652413 2228248838 460
81 3300000062 IMNBL1DRAFT_c0005132 IMNBL1DRAFT_000513210 460
82 3300042605 Ga0466716_484837 Ga0466716_484837_26272_27654 460
83 3300042624 Ga0466735_008785 Ga0466735_008785_4735_6117 460
84 3300042659 Ga0466733_183414 Ga0466733_183414_36963_38345 460
85 iso_pr_bacteria 2940202316 2940202318 460
86 3300042609 Ga0466722_039133 Ga0466722_039133_9158_10543 461
87 3300042609 Ga0466722_173318 Ga0466722_173318_600_1985 461
88 3300042615 Ga0466711_178173 Ga0466711_178173_2329_3714 461
89 3300042615 Ga0466711_404115 Ga0466711_404115_42040_43425 461
90 3300042619 Ga0466726_307227 Ga0466726_307227_1822_3207 461
91 3300042621 Ga0466729_091329 Ga0466729_091329_840_2225 461
92 3300042624 Ga0466735_128473 Ga0466735_128473_24_1409 461
93 3300042652 Ga0466708_254262 Ga0466708_254262_7592_8977 461
94 3300042654 Ga0466725_359981 Ga0466725_359981_821_2206 461
95 3300042655 Ga0466727_290618 Ga0466727_290618_5844_7229 461
96 3300005071 Ga0068302_10215373 Ga0068302_102153734 462
97 3300042582 Ga0466657_389886 Ga0466657_389886_530_1918 462
98 3300042611 Ga0466697_186481 Ga0466697_186481_5863_7251 462
99 3300042616 Ga0466715_455126 Ga0466715_455126_1359_2747 462
100 3300042643 Ga0466704_222113 Ga0466704_222113_656_2044 462
101 3300042659 Ga0466733_192917 Ga0466733_192917_37845_39233 462
102 3300042659 Ga0466733_215275 Ga0466733_215275_1547_2935 462
103 3300002509 JGI24699J35502_11133800 JGI24699J35502_111338003 463
104 3300042636 Ga0466703_191485 Ga0466703_191485_695_2086 463
105 3300002462 JGI24702J35022_10010809 JGI24702J35022_100108095 464
106 3300024582 Ga0265387_1007015 Ga0265387_10070151 464
107 3300042601 Ga0466707_022979 Ga0466707_022979_8118_9515 465
108 iso_pr_bacteria 2940195863 2940197044 465
109 iso_pr_bacteria 2940199050 2940199888 465
110 iso_pr_bacteria 2940209341 2940209628 465
111 iso_pr_bacteria 2940346213 2940346851 465
112 3300010882 Ga0123354_10082162 Ga0123354_100821623 466
113 2225789004 2227581849 2228134250 473
114 3300042654 Ga0466725_165576 Ga0466725_165576_1980_3404 474
115 3300042615 Ga0466711_458035 Ga0466711_458035_12563_14026 479
116 3300010049 Ga0123356_10055686 Ga0123356_100556862 481
117 3300042598 Ga0466701_026085 Ga0466701_026085_4445_5896 483
118 3300042622 Ga0466731_270234 Ga0466731_270234_623_2074 483
119 2225789004 2227601855 2228168087 484
120 3300010167 Ga0123353_10266112 Ga0123353_102661123 484
121 3300010167 Ga0123353_10494356 Ga0123353_104943562 484
122 3300042590 Ga0466690_341657 Ga0466690_341657_1520_2989 484
123 3300010167 Ga0123353_10038277 Ga0123353_100382774 485
124 3300010167 Ga0123353_10060772 Ga0123353_100607725 485
125 3300010882 Ga0123354_10208188 Ga0123354_102081882 485
126 3300042652 Ga0466708_129066 Ga0466708_129066_197_1678 485
127 3300005201 Ga0072941_1201102 Ga0072941_12011022 486
128 3300042617 Ga0466718_112585 Ga0466718_112585_46_1509 487
129 3300042620 Ga0466728_008122 Ga0466728_008122_1510_2973 487
130 3300042550 Ga0466656_203770 Ga0466656_203770_719_2188 489
131 3300042598 Ga0466701_080415 Ga0466701_080415_126_1595 489
132 3300042604 Ga0466717_069287 Ga0466717_069287_414_1883 489
133 3300042606 Ga0466719_177993 Ga0466719_177993_1801_3270 489
134 3300042611 Ga0466697_238690 Ga0466697_238690_347_1816 489
135 3300002462 JGI24702J35022_10020751 JGI24702J35022_100207512 490
136 3300002504 JGI24705J35276_12238552 JGI24705J35276_122385525 490
137 3300002462 JGI24702J35022_10007701 JGI24702J35022_100077013 491
138 3300042616 Ga0466715_006176 Ga0466715_006176_14592_16067 491
139 3300002462 JGI24702J35022_10012058 JGI24702J35022_100120583 492
140 3300005071 Ga0068302_10061352 Ga0068302_100613522 492
141 3300042612 Ga0466705_110830 Ga0466705_110830_7176_8654 492
142 3300042616 Ga0466715_008279 Ga0466715_008279_246_1724 492
143 3300042643 Ga0466704_155985 Ga0466704_155985_1877_3355 492
144 3300042590 Ga0466690_085973 Ga0466690_085973_2454_3935 493
145 3300042591 Ga0466692_115633 Ga0466692_115633_5227_6708 493
146 3300042606 Ga0466719_323893 Ga0466719_323893_1171_2652 493
147 3300042616 Ga0466715_015236 Ga0466715_015236_6421_7902 493
148 3300042620 Ga0466728_030334 Ga0466728_030334_2771_4252 493
149 3300042643 Ga0466704_119635 Ga0466704_119635_7612_9093 493
150 3300042594 Ga0466694_354079 Ga0466694_354079_249_1733 494
151 3300042596 Ga0466696_005686 Ga0466696_005686_2389_3873 494
152 3300042618 Ga0466723_029164 Ga0466723_029164_14670_16154 494
153 3300010167 Ga0123353_10363541 Ga0123353_103635412 495
154 3300042648 Ga0466709_020733 Ga0466709_020733_41845_43332 495
155 3300042593 Ga0466691_101293 Ga0466691_101293_7914_9404 496
156 3300042648 Ga0466709_145891 Ga0466709_145891_5896_7386 496
157 3300002462 JGI24702J35022_10053439 JGI24702J35022_100534392 499
158 3300042619 Ga0466726_151678 Ga0466726_151678_622_2157 511

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold 69 196 0.92
PF22725 GFO_IDH_MocA_C3 GFO/IDH/MocA C-terminal domain 207 279 0.9
PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain 210 409 0.88

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01408 GO:0000166 nucleotide binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.