Protein Family IF08232

Metagenome Isolate
141 Members
50 Samples
134 Scaffolds
204.32 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_131662|Ga0466726_131662_5933_6646
Length
237 aa
Sequence
MMAGGLSRGNFCRVAPLAQYALGCYTGGMRVAKEGFPFILIPFAAGVALVVAQNKFVLQPAFAIAGIIFLLASLFCLFFFRDPDISITRGENLVLSPCNGTVLQIDENESAVVIRVFLSIFNVHLQRAPVAGTVRSVEHKDGKFLMAWDPTAHEVNEQNIITIENQAGVFVVKQIAGFLARRCVAWVRAGDTLGAGEQIGLIKFSSQVDLYIPKNVTIKIEKGDKVIAGVTVFGEIT

📊 Sample Types

Isolate 5.0%
Metagenome 95.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 31.9%
Kalotermitidae 29.8%
Unclassified 19.1%
Rhinotermitidae 8.5%
Termopsidae 8.5%
Hodotermitidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 120
Eukaryota 0
Viruses 0
Unclassified 21

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
2 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
8 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
9 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
13 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
14 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
15 2772190893 Unclassified Elusimicrobia Nt197P4_bin29 Isolate Unclassified
16 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
19 2772190891 Unclassified Elusimicrobia Emb289P1_bin41 Isolate Unclassified
20 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
21 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
22 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
23 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
24 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
25 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
26 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
27 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
28 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
29 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
30 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
31 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
32 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
33 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
34 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
35 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
36 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
37 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
38 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
39 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
40 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
41 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
42 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
43 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
44 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
45 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
46 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
47 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
48 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
49 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
50 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_007544 3300042614 Unclassified 1956
2 Ga0466712_046280 3300042614 Unclassified 2993
3 Ga0466711_184600 3300042615 Bacteria 1883
4 Ga0466711_360385 3300042615 Unclassified 1416
5 Ga0466711_517825 3300042615 Bacteria 192770
6 Ga0466715_087247 3300042616 Bacteria 3997
7 Ga0466715_174983 3300042616 Bacteria 4113
8 Ga0466718_037834 3300042617 Bacteria 7306
9 Ga0466726_000708 3300042619 Bacteria 10450
10 Ga0466726_131662 3300042619 Bacteria 7809
11 Ga0466726_376117 3300042619 Unclassified 4595
12 Ga0466728_162830 3300042620 Bacteria 2956
13 Ga0466690_125010 3300042590 Unclassified 6696
14 Ga0123356_10003822 3300010049 Bacteria 15682
15 Ga0072941_1011847 3300005201 Bacteria 41565
16 Ga0466704_167270 3300042643 Bacteria 32596
17 Ga0466704_173565 3300042643 Bacteria 4288
18 Ga0466706_148071 3300042599 Bacteria 16150
19 Ga0466706_175790 3300042599 Bacteria 85125
20 Ga0466706_269790 3300042599 Bacteria 3461
21 Ga0466720_080189 3300042607 Bacteria 5744
22 Ga0466722_135185 3300042609 Bacteria 2180
23 Ga0466705_257444 3300042612 Unclassified 3623
24 Ga0466711_026838 3300042615 Bacteria 6175
25 Ga0466711_157498 3300042615 Bacteria 313285
26 Ga0466715_237129 3300042616 Bacteria 4810
27 Ga0466715_436492 3300042616 Bacteria 169505
28 Ga0466728_376471 3300042620 Bacteria 29181
29 Ga0466692_134817 3300042591 Bacteria 2563
30 Ga0466691_008423 3300042593 Unclassified 4387
31 AustNasuHG_c1008804 3300000089 Bacteria 3570
32 JGI24698J34947_10023167 3300002449 Bacteria 3323
33 JGI24695J34938_10006145 3300002450 Bacteria 7308
34 Ga0072940_1024472 3300005200 Bacteria 10631
35 Ga0105524_101117 3300007733 Bacteria 14994
36 Ga0466729_300531 3300042621 Bacteria 2751
37 Ga0466735_161132 3300042624 Bacteria 2427
38 Ga0466703_395188 3300042636 Bacteria 299836
39 Ga0466727_340290 3300042655 Bacteria 1100
40 Ga0466706_046897 3300042599 Bacteria 1981
41 Ga0466707_096461 3300042601 Bacteria 10947
42 Ga0466716_428733 3300042605 Bacteria 11835
43 Ga0466732_095875 3300042656 Bacteria 5113
44 Ga0466715_026423 3300042616 Bacteria 13433
45 Ga0466715_231333 3300042616 Bacteria 11807
46 Ga0466726_014370 3300042619 Bacteria 10642
47 Ga0466690_117834 3300042590 Unclassified 7847
48 Ga0466692_096022 3300042591 Bacteria 1057
49 Ga0466692_147464 3300042591 Bacteria 6857
50 Ga0123356_10024458 3300010049 Bacteria 5683
51 JGI24695J34938_10013275 3300002450 Bacteria 4333
52 Ga0068302_10241918 3300005071 Unclassified 2421
53 Ga0068305_10000090 3300005083 Bacteria 152414
54 Ga0466735_098210 3300042624 Bacteria 1523
55 Ga0466708_375635 3300042652 Bacteria 2721
56 Ga0466706_087976 3300042599 Bacteria 1933
57 Ga0466707_026300 3300042601 Bacteria 1073
58 Ga0466716_253743 3300042605 Bacteria 13090
59 Ga0466720_130772 3300042607 Bacteria 3471
60 Ga0466722_038058 3300042609 Bacteria 9555
61 Ga0466722_081790 3300042609 Bacteria 5653
62 Ga0466722_169113 3300042609 Bacteria 13744
63 Ga0466723_115745 3300042618 Unclassified 14287
64 Ga0466726_042182 3300042619 Bacteria 5540
65 Ga0466726_176094 3300042619 Bacteria 1247
66 Ga0264413_109154 3300024493 Bacteria 29350
67 Ga0466690_039786 3300042590 Bacteria 31557
68 Ga0466690_428533 3300042590 Bacteria 5657
69 Ga0466692_079913 3300042591 Bacteria 2197
70 Ga0466692_158407 3300042591 Bacteria 2193
71 Ga0466694_022397 3300042594 Bacteria 1071
72 AustNasuHG_c1022033 3300000089 Bacteria 2053
73 Ga0466709_381909 3300042648 Bacteria 1169
74 Ga0466714_147954 3300042603 Bacteria 24894
75 Ga0466719_279868 3300042606 Unclassified 70703
76 Ga0466715_452025 3300042616 Bacteria 7649
77 Ga0466718_044235 3300042617 Bacteria 13630
78 Ga0466723_211182 3300042618 Bacteria 6738
79 Ga0466726_033034 3300042619 Bacteria 2340
80 Ga0466690_106733 3300042590 Bacteria 20618
81 Ga0466694_058984 3300042594 Bacteria 1481
82 Ga0466703_282383 3300042636 Bacteria 9225
83 Ga0466709_166617 3300042648 Bacteria 1132
84 Ga0466727_231739 3300042655 Bacteria 3977
85 Ga0466716_057010 3300042605 Bacteria 13488
86 Ga0466722_059054 3300042609 Bacteria 16418
87 Ga0466705_158580 3300042612 Bacteria 1078
88 Ga0466723_370249 3300042618 Bacteria 19218
89 Ga0466690_044467 3300042590 Unclassified 8061
90 Ga0123354_10004848 3300010882 Bacteria 19269
91 JGI24698J34947_10105477 3300002449 Unclassified 1256
92 JGI24695J34938_10000579 3300002450 Bacteria 35323
93 Ga0068302_10049829 3300005071 Unclassified 6709
94 Ga0466731_436851 3300042622 Bacteria 2921
95 Ga0466727_193700 3300042655 Bacteria 75615
96 Ga0466727_317931 3300042655 Bacteria 1600
97 Ga0466707_070508 3300042601 Bacteria 2276
98 Ga0466712_019504 3300042614 Bacteria 24968
99 Ga0466711_373870 3300042615 Bacteria 1153
100 Ga0466718_078695 3300042617 Bacteria 2540
101 Ga0466723_144369 3300042618 Unclassified 13499
102 Ga0466723_349762 3300042618 Bacteria 17821
103 Ga0466726_111986 3300042619 Bacteria 1365
104 Ga0466726_276235 3300042619 Bacteria 1824
105 Ga0466726_298507 3300042619 Bacteria 32614
106 Ga0466692_029348 3300042591 Bacteria 6192
107 Ga0466691_136697 3300042593 Bacteria 59104
108 Ga0466694_207936 3300042594 Bacteria 26092
109 Ga0466696_296078 3300042596 Unclassified 32496
110 Ga0123357_10040765 3300009784 Bacteria 6315
111 Ga0123355_10142212 3300009826 Unclassified 3668
112 JGI24698J34947_10040566 3300002449 Bacteria 2402
113 Ga0072941_1217214 3300005201 Bacteria 2599
114 Ga0466731_323005 3300042622 Bacteria 29888
115 Ga0466735_060020 3300042624 Bacteria 2426
116 Ga0466708_183214 3300042652 Bacteria 1333
117 Ga0466716_009888 3300042605 Bacteria 2657
118 Ga0466720_073079 3300042607 Unclassified 2338
119 Ga0466705_143986 3300042612 Bacteria 113378
120 Ga0466705_366145 3300042612 Bacteria 10951
121 Ga0466712_164260 3300042614 Bacteria 8201
122 Ga0466715_292910 3300042616 Bacteria 20486
123 Ga0466718_067823 3300042617 Bacteria 18371
124 Ga0466723_010058 3300042618 Bacteria 32633
125 Ga0456237_0001386 3300041968 Unclassified 3859
126 Ga0466696_042783 3300042596 Bacteria 3556
127 JGI24698J34947_10027112 3300002449 Bacteria 3041
128 Ga0068305_10011079 3300005083 Unclassified 2129
129 Ga0072941_1052160 3300005201 Bacteria 9148
130 Ga0466729_300056 3300042621 Bacteria 1131
131 Ga0466708_064904 3300042652 Unclassified 1497
132 Ga0466727_168952 3300042655 Bacteria 1127
133 Ga0466706_166478 3300042599 Bacteria 103376
134 Ga0466719_040767 3300042606 Bacteria 242892

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_026300 Ga0466707_026300_345_986 181
2 3300042624 Ga0466735_161132 Ga0466735_161132_1040_1681 181
3 3300042652 Ga0466708_064904 Ga0466708_064904_145_789 181
4 3300042621 Ga0466729_300056 Ga0466729_300056_95_733 183
5 3300042609 Ga0466722_135185 Ga0466722_135185_732_1376 190
6 3300042616 Ga0466715_292910 Ga0466715_292910_15585_16259 190
7 3300042606 Ga0466719_040767 Ga0466719_040767_242026_242655 191
8 3300042615 Ga0466711_026838 Ga0466711_026838_3359_4009 192
9 3300005201 Ga0072941_1052160 Ga0072941_10521602 193
10 3300010049 Ga0123356_10024458 Ga0123356_100244584 193
11 3300042591 Ga0466692_029348 Ga0466692_029348_2408_3067 193
12 3300042652 Ga0466708_375635 Ga0466708_375635_954_1604 193
13 3300042590 Ga0466690_044467 Ga0466690_044467_6723_7385 194
14 3300042609 Ga0466722_059054 Ga0466722_059054_9837_10454 194
15 3300042612 Ga0466705_366145 Ga0466705_366145_9627_10250 194
16 3300042616 Ga0466715_436492 Ga0466715_436492_93582_94199 194
17 3300042655 Ga0466727_231739 Ga0466727_231739_89_706 194
18 3300000089 AustNasuHG_c1008804 AustNasuHG_10088042 195
19 3300042617 Ga0466718_067823 Ga0466718_067823_8513_9148 195
20 3300042591 Ga0466692_147464 Ga0466692_147464_3702_4328 196
21 3300042596 Ga0466696_042783 Ga0466696_042783_450_1070 196
22 3300042614 Ga0466712_007544 Ga0466712_007544_773_1408 196
23 3300042614 Ga0466712_046280 Ga0466712_046280_817_1455 196
24 3300042619 Ga0466726_111986 Ga0466726_111986_414_1046 196
25 3300042619 Ga0466726_376117 Ga0466726_376117_314_946 196
26 3300042648 Ga0466709_166617 Ga0466709_166617_32_679 196
27 3300042652 Ga0466708_183214 Ga0466708_183214_589_1233 196
28 3300002449 JGI24698J34947_10105477 JGI24698J34947_101054773 197
29 3300005201 Ga0072941_1011847 Ga0072941_101184717 197
30 3300042607 Ga0466720_073079 Ga0466720_073079_397_1032 197
31 3300042607 Ga0466720_130772 Ga0466720_130772_382_1017 197
32 3300042612 Ga0466705_257444 Ga0466705_257444_2240_2911 197
33 3300042614 Ga0466712_164260 Ga0466712_164260_1799_2437 197
34 3300042620 Ga0466728_376471 Ga0466728_376471_14460_15080 197
35 3300002449 JGI24698J34947_10027112 JGI24698J34947_100271123 198
36 3300042599 Ga0466706_166478 Ga0466706_166478_17386_18015 198
37 3300042622 Ga0466731_323005 Ga0466731_323005_23033_23680 198
38 3300042655 Ga0466727_193700 Ga0466727_193700_63933_64559 198
39 3300002449 JGI24698J34947_10023167 JGI24698J34947_100231673 199
40 3300005071 Ga0068302_10049829 Ga0068302_100498295 199
41 3300042591 Ga0466692_096022 Ga0466692_096022_399_1046 199
42 3300042615 Ga0466711_184600 Ga0466711_184600_956_1600 199
43 3300005200 Ga0072940_1024472 Ga0072940_10244727 200
44 3300042614 Ga0466712_019504 Ga0466712_019504_775_1422 200
45 3300042617 Ga0466718_078695 Ga0466718_078695_392_1036 200
46 3300042619 Ga0466726_176094 Ga0466726_176094_454_1101 200
47 3300042643 Ga0466704_173565 Ga0466704_173565_774_1445 200
48 3300010049 Ga0123356_10003822 Ga0123356_1000382211 201
49 3300042591 Ga0466692_079913 Ga0466692_079913_551_1192 201
50 3300042607 Ga0466720_080189 Ga0466720_080189_4233_4868 201
51 3300042594 Ga0466694_207936 Ga0466694_207936_16426_17064 202
52 3300042601 Ga0466707_070508 Ga0466707_070508_423_1064 202
53 3300042618 Ga0466723_370249 Ga0466723_370249_14703_15377 202
54 3300005201 Ga0072941_1217214 Ga0072941_12172143 203
55 3300042594 Ga0466694_058984 Ga0466694_058984_635_1273 203
56 3300002450 JGI24695J34938_10000579 JGI24695J34938_1000057929 204
57 3300042615 Ga0466711_360385 Ga0466711_360385_141_755 204
58 3300042615 Ga0466711_373870 Ga0466711_373870_471_1085 204
59 3300042591 Ga0466692_134817 Ga0466692_134817_279_896 205
60 3300042601 Ga0466707_096461 Ga0466707_096461_5776_6393 205
61 3300042605 Ga0466716_057010 Ga0466716_057010_3272_3889 205
62 3300042609 Ga0466722_169113 Ga0466722_169113_4642_5259 205
63 3300042612 Ga0466705_158580 Ga0466705_158580_414_1031 205
64 3300042619 Ga0466726_033034 Ga0466726_033034_797_1414 205
65 3300042619 Ga0466726_276235 Ga0466726_276235_805_1422 205
66 3300042619 Ga0466726_298507 Ga0466726_298507_3605_4252 205
67 iso_pr_bacteria 2754412482 2755214936 205
68 iso_pr_bacteria 2754412483 2755217300 205
69 iso_pr_bacteria 2772190891 2773434868 205
70 iso_pr_bacteria 2772190892 2773436537 205
71 iso_pr_bacteria 2772190893 2773437437 205
72 iso_pr_bacteria 2772190894 2773439233 205
73 3300005071 Ga0068302_10241918 Ga0068302_102419182 206
74 3300009826 Ga0123355_10142212 Ga0123355_101422122 206
75 3300010882 Ga0123354_10004848 Ga0123354_1000484815 206
76 3300042593 Ga0466691_136697 Ga0466691_136697_4888_5508 206
77 3300042599 Ga0466706_046897 Ga0466706_046897_354_974 206
78 3300042603 Ga0466714_147954 Ga0466714_147954_5476_6096 206
79 3300042616 Ga0466715_237129 Ga0466715_237129_578_1198 206
80 3300042616 Ga0466715_452025 Ga0466715_452025_97_717 206
81 3300042618 Ga0466723_010058 Ga0466723_010058_16603_17223 206
82 3300042636 Ga0466703_282383 Ga0466703_282383_5221_5841 206
83 3300042594 Ga0466694_022397 Ga0466694_022397_418_1056 207
84 3300042599 Ga0466706_148071 Ga0466706_148071_10029_10652 207
85 3300042648 Ga0466709_381909 Ga0466709_381909_24_674 207
86 3300009784 Ga0123357_10040765 Ga0123357_100407655 208
87 3300024493 Ga0264413_109154 Ga0264413_10915412 208
88 3300042590 Ga0466690_106733 Ga0466690_106733_14265_14891 208
89 3300042590 Ga0466690_117834 Ga0466690_117834_2268_2894 208
90 3300042590 Ga0466690_125010 Ga0466690_125010_3164_3790 208
91 3300042590 Ga0466690_428533 Ga0466690_428533_1855_2481 208
92 3300042591 Ga0466692_158407 Ga0466692_158407_1256_1882 208
93 3300042593 Ga0466691_008423 Ga0466691_008423_1447_2073 208
94 3300042596 Ga0466696_296078 Ga0466696_296078_17405_18031 208
95 3300042599 Ga0466706_175790 Ga0466706_175790_9930_10556 208
96 3300042605 Ga0466716_253743 Ga0466716_253743_3829_4455 208
97 3300042605 Ga0466716_428733 Ga0466716_428733_6669_7295 208
98 3300042606 Ga0466719_279868 Ga0466719_279868_10835_11461 208
99 3300042615 Ga0466711_157498 Ga0466711_157498_143532_144158 208
100 3300042616 Ga0466715_026423 Ga0466715_026423_11700_12326 208
101 3300042616 Ga0466715_231333 Ga0466715_231333_8593_9219 208
102 3300042618 Ga0466723_115745 Ga0466723_115745_8776_9402 208
103 3300042618 Ga0466723_144369 Ga0466723_144369_2933_3559 208
104 3300042618 Ga0466723_211182 Ga0466723_211182_3182_3808 208
105 3300042618 Ga0466723_349762 Ga0466723_349762_12291_12917 208
106 3300042636 Ga0466703_395188 Ga0466703_395188_136202_136828 208
107 3300005083 Ga0068305_10000090 Ga0068305_100000905 209
108 3300042590 Ga0466690_039786 Ga0466690_039786_13228_13857 209
109 3300042612 Ga0466705_143986 Ga0466705_143986_86934_87563 209
110 3300042616 Ga0466715_174983 Ga0466715_174983_2384_3055 209
111 3300042619 Ga0466726_000708 Ga0466726_000708_4972_5601 209
112 3300042619 Ga0466726_042182 Ga0466726_042182_1186_1815 209
113 3300042624 Ga0466735_060020 Ga0466735_060020_513_1142 209
114 3300042655 Ga0466727_168952 Ga0466727_168952_162_791 209
115 3300041968 Ga0456237_0001386 Ga0456237_0001386_2302_2934 210
116 3300042617 Ga0466718_044235 Ga0466718_044235_7446_8081 211
117 3300042620 Ga0466728_162830 Ga0466728_162830_734_1396 211
118 3300042624 Ga0466735_098210 Ga0466735_098210_771_1406 211
119 3300000089 AustNasuHG_c1022033 AustNasuHG_10220333 212
120 3300042619 Ga0466726_014370 Ga0466726_014370_5777_6415 212
121 3300002449 JGI24698J34947_10040566 JGI24698J34947_100405663 213
122 3300005083 Ga0068305_10011079 Ga0068305_100110793 213
123 3300042599 Ga0466706_087976 Ga0466706_087976_76_753 214
124 3300042609 Ga0466722_038058 Ga0466722_038058_5652_6296 214
125 3300042615 Ga0466711_517825 Ga0466711_517825_149760_150404 214
126 3300042617 Ga0466718_037834 Ga0466718_037834_3005_3649 214
127 iso_pr_bacteria 2781125646 2781301028 214
128 3300042621 Ga0466729_300531 Ga0466729_300531_1773_2420 215
129 3300007733 Ga0105524_101117 Ga0105524_1011175 216
130 3300042605 Ga0466716_009888 Ga0466716_009888_881_1531 216
131 3300042616 Ga0466715_087247 Ga0466715_087247_2161_2811 216
132 3300042655 Ga0466727_340290 Ga0466727_340290_377_1027 216
133 3300002450 JGI24695J34938_10006145 JGI24695J34938_100061456 217
134 3300042622 Ga0466731_436851 Ga0466731_436851_56_709 217
135 3300042656 Ga0466732_095875 Ga0466732_095875_415_1068 217
136 3300042599 Ga0466706_269790 Ga0466706_269790_1815_2474 219
137 3300042609 Ga0466722_081790 Ga0466722_081790_4014_4673 219
138 3300002450 JGI24695J34938_10013275 JGI24695J34938_100132753 220
139 3300042655 Ga0466727_317931 Ga0466727_317931_722_1384 220
140 3300042643 Ga0466704_167270 Ga0466704_167270_18253_18936 227
141 3300042619 Ga0466726_131662 Ga0466726_131662_5933_6646 237

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02666 PS_Dcarbxylase Phosphatidylserine decarboxylase 74 233 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.81 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.