Protein Family IF08220
Metagenome
Isolate
132
Members
61
Samples
114
Scaffolds
340.23
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_091831|Ga0466726_091831_746_1885
- Length
- 379 aa
- Sequence
- LQQHRTSTLALSHIAYRKSHSRKKVLPLHPFFASLSSQEKNNILKTAVVILSWNGEKFLRQLLPTVVAHSADAQAEVVVADNGSTDGSVAFVRQALPQVRLVLLDRNYGFTGGYNRALASVDADYAVLLNSDVSVPQGWLQPLVAYMDAHPDTAACMPKILSFAQPTRFEYAGAAGGFIDILGYPFCRGRVLGTLEDDLGQYNDTREIFWATGACMLVRTALYKALGGLDDDFFAHMEEIDLCWRMKNAGYKIAYVGEASVLHVGGGTLPNNNPRKMFFNYRNNLLMLHKNLSPRLHLPVLALRFVLDWVSALAFALQLRFSFAAAVFKAHRAFFILKKGKRHAAQTQSLRRLTGVYCGSIVAAYFLRQRKTFNDLMKS
Sample Types
Isolate
13.6%
Metagenome
86.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
25.4%
Kalotermitidae
23.7%
Unclassified
18.6%
Blattidae
8.5%
Rhinotermitidae
6.8%
Termopsidae
5.1%
Passalidae
3.4%
Pyroglyphidae
1.7%
Aphelinidae
1.7%
Hydrophilidae
1.7%
Delphacidae
1.7%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
132
Eukaryota
0
Viruses
0
Unclassified
0
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 2 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 3 | 3000153175 | Cardinium endosymbiont of Dermatophagoides farinae UMMZ BMOC 05-0812-001 | Isolate | Pyroglyphidae |
| 4 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 5 | 3300003131 | Encarsia pergandiella symbiont microbial communities from Weslaco, Texas | Metagenome | Aphelinidae |
| 6 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 7 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 8 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 9 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 10 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 11 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 12 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 13 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 14 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 15 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 16 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 19 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 20 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 21 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 22 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 23 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 26 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 27 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 28 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 29 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 30 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 31 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 32 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 33 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 34 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 35 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 36 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 37 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 38 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 41 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 42 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 45 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 46 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 47 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 48 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 49 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 50 | 3000336795 | Cardinium endosymbiont of Sogatella furcifera cSfur | Isolate | Delphacidae |
| 51 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 52 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 53 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 54 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 55 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 56 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 57 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 58 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 59 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 60 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 61 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466708_328768 | 3300042652 | Bacteria | 20898 |
| 2 | Ga0466727_282261 | 3300042655 | Bacteria | 14300 |
| 3 | Ga0466705_466695 | 3300042612 | Bacteria | 17364 |
| 4 | Ga0466690_103898 | 3300042590 | Bacteria | 4389 |
| 5 | Ga0466691_210405 | 3300042593 | Bacteria | 3921 |
| 6 | Ga0466696_137717 | 3300042596 | Bacteria | 22521 |
| 7 | 2227080794 | 2225789004 | Bacteria | 41653 |
| 8 | Ga0123356_10040726 | 3300010049 | Bacteria | 4328 |
| 9 | Ga0123353_10395383 | 3300010167 | Bacteria | 2060 |
| 10 | Ga0466706_048142 | 3300042599 | Bacteria | 37807 |
| 11 | Ga0466719_180231 | 3300042606 | Bacteria | 22873 |
| 12 | Ga0466703_356422 | 3300042636 | Bacteria | 3827 |
| 13 | Ga0466704_486310 | 3300042643 | Bacteria | 39029 |
| 14 | Ga0466708_128737 | 3300042652 | Bacteria | 11637 |
| 15 | Ga0466708_148679 | 3300042652 | Bacteria | 8986 |
| 16 | Ga0466711_517350 | 3300042615 | Bacteria | 1621 |
| 17 | Ga0466715_383915 | 3300042616 | Bacteria | 3884 |
| 18 | Ga0466726_185798 | 3300042619 | Bacteria | 2965 |
| 19 | Ga0466726_415435 | 3300042619 | Bacteria | 2155 |
| 20 | Ga0466728_008320 | 3300042620 | Bacteria | 7449 |
| 21 | Ga0466729_029479 | 3300042621 | Bacteria | 4536 |
| 22 | Ga0466692_089897 | 3300042591 | Bacteria | 3442 |
| 23 | Ga0466691_082749 | 3300042593 | Bacteria | 46713 |
| 24 | Ga0466696_007849 | 3300042596 | Bacteria | 54852 |
| 25 | Ga0466696_120561 | 3300042596 | Bacteria | 43533 |
| 26 | Ga0466696_227581 | 3300042596 | Bacteria | 20008 |
| 27 | Ga0466733_031314 | 3300042659 | Bacteria | 5896 |
| 28 | Ga0123356_10229811 | 3300010049 | Bacteria | 1918 |
| 29 | Ga0123356_10533231 | 3300010049 | Bacteria | 1333 |
| 30 | Ga0466700_084730 | 3300042600 | Bacteria | 2087 |
| 31 | Ga0466713_020238 | 3300042602 | Bacteria | 5699 |
| 32 | Ga0466714_155308 | 3300042603 | Bacteria | 2891 |
| 33 | Ga0466714_157522 | 3300042603 | Bacteria | 5031 |
| 34 | Ga0466721_113574 | 3300042608 | Bacteria | 34320 |
| 35 | Ga0466722_144985 | 3300042609 | Bacteria | 6663 |
| 36 | Ga0466722_187749 | 3300042609 | Bacteria | 12297 |
| 37 | Ga0466735_005381 | 3300042624 | Bacteria | 2921 |
| 38 | Ga0466735_060243 | 3300042624 | Bacteria | 5861 |
| 39 | Ga0466735_128622 | 3300042624 | Bacteria | 3668 |
| 40 | Ga0466703_115104 | 3300042636 | Bacteria | 5668 |
| 41 | Ga0466727_033699 | 3300042655 | Bacteria | 3189 |
| 42 | Ga0466715_045235 | 3300042616 | Bacteria | 6029 |
| 43 | Ga0466723_093572 | 3300042618 | Bacteria | 20624 |
| 44 | Ga0466690_027027 | 3300042590 | Bacteria | 9640 |
| 45 | Ga0466696_289430 | 3300042596 | Bacteria | 8723 |
| 46 | JGI24702J35022_10003442 | 3300002462 | Bacteria | 9533 |
| 47 | Ga0466697_181224 | 3300042611 | Bacteria | 3059 |
| 48 | Ga0123356_10002851 | 3300010049 | Bacteria | 18293 |
| 49 | Ga0123353_10186629 | 3300010167 | Bacteria | 3278 |
| 50 | Ga0466714_032508 | 3300042603 | Bacteria | 28301 |
| 51 | Ga0466703_039977 | 3300042636 | Bacteria | 12863 |
| 52 | Ga0466703_053718 | 3300042636 | Bacteria | 3003 |
| 53 | Ga0466704_060132 | 3300042643 | Bacteria | 107799 |
| 54 | Ga0466704_120917 | 3300042643 | Bacteria | 17399 |
| 55 | Ga0466711_363285 | 3300042615 | Bacteria | 32228 |
| 56 | Ga0466715_181634 | 3300042616 | Bacteria | 4275 |
| 57 | Ga0466723_087794 | 3300042618 | Bacteria | 35967 |
| 58 | Ga0466691_080715 | 3300042593 | Bacteria | 6729 |
| 59 | Ga0466691_128965 | 3300042593 | Bacteria | 19997 |
| 60 | IMNBL1DRAFT_c0000765 | 3300000062 | Bacteria | 25410 |
| 61 | Ga0123356_10427829 | 3300010049 | Bacteria | 1467 |
| 62 | Ga0466713_067964 | 3300042602 | Bacteria | 5715 |
| 63 | Ga0466714_149913 | 3300042603 | Bacteria | 1308 |
| 64 | Ga0466716_236813 | 3300042605 | Bacteria | 9488 |
| 65 | Ga0466716_429486 | 3300042605 | Bacteria | 4941 |
| 66 | Ga0466731_196277 | 3300042622 | Bacteria | 1495 |
| 67 | Ga0466709_108564 | 3300042648 | Bacteria | 18399 |
| 68 | Ga0466708_058687 | 3300042652 | Bacteria | 40531 |
| 69 | Ga0466725_358109 | 3300042654 | Bacteria | 1793 |
| 70 | Ga0466727_100048 | 3300042655 | Bacteria | 1988 |
| 71 | Ga0466711_057204 | 3300042615 | Bacteria | 4437 |
| 72 | Ga0466723_120806 | 3300042618 | Bacteria | 23212 |
| 73 | Ga0466729_000478 | 3300042621 | Bacteria | 4830 |
| 74 | Ga0466729_189926 | 3300042621 | Bacteria | 4935 |
| 75 | Ga0052165_100012 | 3300003131 | Bacteria | 18596 |
| 76 | Ga0466705_284351 | 3300042612 | Bacteria | 2513 |
| 77 | Ga0123353_10087873 | 3300010167 | Bacteria | 5006 |
| 78 | Ga0466706_168917 | 3300042599 | Bacteria | 75730 |
| 79 | Ga0466706_196142 | 3300042599 | Bacteria | 22966 |
| 80 | Ga0466719_228557 | 3300042606 | Bacteria | 4022 |
| 81 | Ga0466722_037020 | 3300042609 | Bacteria | 9729 |
| 82 | Ga0466703_381814 | 3300042636 | Bacteria | 6573 |
| 83 | Ga0466705_465403 | 3300042612 | Bacteria | 32062 |
| 84 | Ga0466723_065795 | 3300042618 | Bacteria | 9437 |
| 85 | Ga0466726_091831 | 3300042619 | Bacteria | 2124 |
| 86 | Ga0466728_240185 | 3300042620 | Bacteria | 6281 |
| 87 | Ga0264413_154137 | 3300024493 | Bacteria | 2152 |
| 88 | Ga0466657_244615 | 3300042582 | Bacteria | 77081 |
| 89 | Ga0466690_088921 | 3300042590 | Bacteria | 12214 |
| 90 | Ga0466691_162062 | 3300042593 | Bacteria | 7215 |
| 91 | Ga0466696_035891 | 3300042596 | Bacteria | 6230 |
| 92 | IMNBL1DRAFT_c0005358 | 3300000062 | Bacteria | 7363 |
| 93 | JGI24705J35276_12238375 | 3300002504 | Bacteria | 20419 |
| 94 | Ga0072941_1064385 | 3300005201 | Bacteria | 11729 |
| 95 | Ga0123356_10659735 | 3300010049 | Bacteria | 1214 |
| 96 | Ga0123353_10094803 | 3300010167 | Bacteria | 4809 |
| 97 | Ga0466707_072578 | 3300042601 | Bacteria | 15033 |
| 98 | Ga0466709_341543 | 3300042648 | Bacteria | 3881 |
| 99 | Ga0466710_101979 | 3300042613 | Bacteria | 2942 |
| 100 | Ga0466715_046690 | 3300042616 | Bacteria | 70037 |
| 101 | Ga0466715_418895 | 3300042616 | Bacteria | 29319 |
| 102 | Ga0466726_128363 | 3300042619 | Bacteria | 8103 |
| 103 | Ga0466656_152874 | 3300042550 | Bacteria | 1370 |
| 104 | Ga0466691_193575 | 3300042593 | Bacteria | 3456 |
| 105 | Ga0466705_085149 | 3300042612 | Bacteria | 2989 |
| 106 | Ga0466733_200504 | 3300042659 | Bacteria | 2552 |
| 107 | Ga0466716_182998 | 3300042605 | Bacteria | 4401 |
| 108 | Ga0466716_534970 | 3300042605 | Bacteria | 2917 |
| 109 | Ga0466719_319408 | 3300042606 | Bacteria | 3991 |
| 110 | Ga0466704_165836 | 3300042643 | Bacteria | 3374 |
| 111 | Ga0466723_135338 | 3300042618 | Bacteria | 28340 |
| 112 | IMNBL1DRAFT_c0026989 | 3300000062 | Bacteria | 2170 |
| 113 | Ga0072941_1153157 | 3300005201 | Bacteria | 3468 |
| 114 | Ga0123357_10001395 | 3300009784 | Bacteria | 25599 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042550 | Ga0466656_152874 | Ga0466656_152874_494_1327 | 277 |
| 2 | 3300042600 | Ga0466700_084730 | Ga0466700_084730_497_1399 | 300 |
| 3 | 3300042599 | Ga0466706_196142 | Ga0466706_196142_16650_17660 | 304 |
| 4 | 3300000062 | IMNBL1DRAFT_c0005358 | IMNBL1DRAFT_00053586 | 320 |
| 5 | 3300042612 | Ga0466705_284351 | Ga0466705_284351_1205_2230 | 325 |
| 6 | 3300042605 | Ga0466716_182998 | Ga0466716_182998_1326_2339 | 326 |
| 7 | 3300042624 | Ga0466735_005381 | Ga0466735_005381_1079_2101 | 326 |
| 8 | 3300042648 | Ga0466709_341543 | Ga0466709_341543_726_1733 | 326 |
| 9 | 3300010049 | Ga0123356_10659735 | Ga0123356_106597351 | 327 |
| 10 | 3300042643 | Ga0466704_486310 | Ga0466704_486310_30649_31668 | 327 |
| 11 | 3300010167 | Ga0123353_10395383 | Ga0123353_103953832 | 328 |
| 12 | 3300042596 | Ga0466696_227581 | Ga0466696_227581_160_1149 | 329 |
| 13 | 3300042636 | Ga0466703_115104 | Ga0466703_115104_2840_3862 | 329 |
| 14 | 3300042616 | Ga0466715_383915 | Ga0466715_383915_686_1699 | 330 |
| 15 | 3300042652 | Ga0466708_128737 | Ga0466708_128737_5937_6944 | 330 |
| 16 | 3300042655 | Ga0466727_282261 | Ga0466727_282261_4647_5642 | 331 |
| 17 | 3300042622 | Ga0466731_196277 | Ga0466731_196277_265_1299 | 334 |
| 18 | 3300042648 | Ga0466709_108564 | Ga0466709_108564_4720_5787 | 334 |
| 19 | iso_pr_bacteria | 2820748953 | 2820750247 | 334 |
| 20 | 3300002504 | JGI24705J35276_12238375 | JGI24705J35276_122383758 | 335 |
| 21 | 3300042596 | Ga0466696_120561 | Ga0466696_120561_12821_13828 | 335 |
| 22 | 3300042603 | Ga0466714_155308 | Ga0466714_155308_1788_2795 | 335 |
| 23 | 3300042616 | Ga0466715_045235 | Ga0466715_045235_695_1723 | 335 |
| 24 | 3300042616 | Ga0466715_418895 | Ga0466715_418895_24500_25507 | 335 |
| 25 | 3300042618 | Ga0466723_087794 | Ga0466723_087794_19772_20779 | 335 |
| 26 | iso_pr_bacteria | 3000336795 | 3000337346 | 335 |
| 27 | 3300005201 | Ga0072941_1064385 | Ga0072941_10643858 | 336 |
| 28 | 3300042593 | Ga0466691_128965 | Ga0466691_128965_4451_5461 | 336 |
| 29 | 3300042619 | Ga0466726_185798 | Ga0466726_185798_612_1622 | 336 |
| 30 | 3300042654 | Ga0466725_358109 | Ga0466725_358109_461_1471 | 336 |
| 31 | 3300042655 | Ga0466727_100048 | Ga0466727_100048_493_1503 | 336 |
| 32 | 3300042659 | Ga0466733_200504 | Ga0466733_200504_1076_2086 | 336 |
| 33 | iso_pr_bacteria | 2820767225 | 2820768103 | 336 |
| 34 | iso_pr_bacteria | 2820772500 | 2820773197 | 336 |
| 35 | iso_pr_bacteria | 2820781750 | 2820782138 | 336 |
| 36 | 3300005201 | Ga0072941_1153157 | Ga0072941_11531572 | 337 |
| 37 | 3300010049 | Ga0123356_10002851 | Ga0123356_100028511 | 337 |
| 38 | 3300010049 | Ga0123356_10229811 | Ga0123356_102298112 | 337 |
| 39 | 3300010049 | Ga0123356_10533231 | Ga0123356_105332311 | 337 |
| 40 | 3300010167 | Ga0123353_10087873 | Ga0123353_100878732 | 337 |
| 41 | 3300010167 | Ga0123353_10186629 | Ga0123353_101866291 | 337 |
| 42 | 3300024493 | Ga0264413_154137 | Ga0264413_1541371 | 337 |
| 43 | 3300042593 | Ga0466691_193575 | Ga0466691_193575_2165_3178 | 337 |
| 44 | 3300042593 | Ga0466691_210405 | Ga0466691_210405_2165_3178 | 337 |
| 45 | 3300042599 | Ga0466706_048142 | Ga0466706_048142_30728_31762 | 337 |
| 46 | 3300042603 | Ga0466714_032508 | Ga0466714_032508_2393_3457 | 337 |
| 47 | 3300042603 | Ga0466714_157522 | Ga0466714_157522_1194_2207 | 337 |
| 48 | 3300042606 | Ga0466719_228557 | Ga0466719_228557_148_1161 | 337 |
| 49 | 3300042620 | Ga0466728_008320 | Ga0466728_008320_6152_7165 | 337 |
| 50 | 3300042652 | Ga0466708_148679 | Ga0466708_148679_7450_8463 | 337 |
| 51 | 3300042659 | Ga0466733_031314 | Ga0466733_031314_921_1934 | 337 |
| 52 | 3300010049 | Ga0123356_10427829 | Ga0123356_104278292 | 338 |
| 53 | 3300010167 | Ga0123353_10094803 | Ga0123353_100948035 | 338 |
| 54 | 3300042590 | Ga0466690_027027 | Ga0466690_027027_8453_9469 | 338 |
| 55 | 3300042606 | Ga0466719_319408 | Ga0466719_319408_290_1306 | 338 |
| 56 | 3300042618 | Ga0466723_093572 | Ga0466723_093572_17683_18699 | 338 |
| 57 | 3300042620 | Ga0466728_240185 | Ga0466728_240185_4735_5751 | 338 |
| 58 | 3300042624 | Ga0466735_128622 | Ga0466735_128622_319_1335 | 338 |
| 59 | 3300042636 | Ga0466703_381814 | Ga0466703_381814_2299_3315 | 338 |
| 60 | 3300042643 | Ga0466704_060132 | Ga0466704_060132_20104_21120 | 338 |
| 61 | 3300042618 | Ga0466723_065795 | Ga0466723_065795_1377_2396 | 339 |
| 62 | 3300042618 | Ga0466723_135338 | Ga0466723_135338_11206_12225 | 339 |
| 63 | 3300042621 | Ga0466729_000478 | Ga0466729_000478_2993_4012 | 339 |
| 64 | 3300042621 | Ga0466729_029479 | Ga0466729_029479_229_1248 | 339 |
| 65 | 3300042636 | Ga0466703_053718 | Ga0466703_053718_326_1345 | 339 |
| 66 | 3300042636 | Ga0466703_356422 | Ga0466703_356422_1830_2849 | 339 |
| 67 | 3300042643 | Ga0466704_165836 | Ga0466704_165836_945_1988 | 339 |
| 68 | 3300042593 | Ga0466691_162062 | Ga0466691_162062_464_1486 | 340 |
| 69 | 3300042596 | Ga0466696_035891 | Ga0466696_035891_540_1562 | 340 |
| 70 | 3300042596 | Ga0466696_289430 | Ga0466696_289430_3391_4413 | 340 |
| 71 | 3300042612 | Ga0466705_085149 | Ga0466705_085149_1820_2863 | 340 |
| 72 | 3300042613 | Ga0466710_101979 | Ga0466710_101979_179_1201 | 340 |
| 73 | 3300042652 | Ga0466708_058687 | Ga0466708_058687_18455_19477 | 340 |
| 74 | iso_pr_bacteria | 2820736622 | 2820737504 | 340 |
| 75 | iso_pr_bacteria | 2820740053 | 2820741605 | 340 |
| 76 | iso_pr_bacteria | 2910949487 | 2910950988 | 340 |
| 77 | 3300002462 | JGI24702J35022_10003442 | JGI24702J35022_100034423 | 341 |
| 78 | 3300042603 | Ga0466714_149913 | Ga0466714_149913_80_1105 | 341 |
| 79 | 3300042612 | Ga0466705_466695 | Ga0466705_466695_12583_13608 | 341 |
| 80 | iso_pr_bacteria | 2910926975 | 2910929930 | 341 |
| 81 | iso_pr_bacteria | 2920168565 | 2920169971 | 341 |
| 82 | iso_pr_bacteria | 2940193328 | 2940194960 | 341 |
| 83 | iso_pr_bacteria | 2940336608 | 2940338246 | 341 |
| 84 | 3300000062 | IMNBL1DRAFT_c0026989 | IMNBL1DRAFT_00269892 | 342 |
| 85 | 3300010049 | Ga0123356_10040726 | Ga0123356_100407262 | 342 |
| 86 | 3300042582 | Ga0466657_244615 | Ga0466657_244615_13902_14930 | 342 |
| 87 | 3300042605 | Ga0466716_236813 | Ga0466716_236813_7735_8763 | 342 |
| 88 | 3300042609 | Ga0466722_144985 | Ga0466722_144985_2365_3393 | 342 |
| 89 | 3300042615 | Ga0466711_057204 | Ga0466711_057204_2073_3101 | 342 |
| 90 | 3300042615 | Ga0466711_517350 | Ga0466711_517350_38_1066 | 342 |
| 91 | 3300042590 | Ga0466690_088921 | Ga0466690_088921_4305_5336 | 343 |
| 92 | 3300042596 | Ga0466696_007849 | Ga0466696_007849_47351_48382 | 343 |
| 93 | 3300042602 | Ga0466713_020238 | Ga0466713_020238_3275_4306 | 343 |
| 94 | 3300042602 | Ga0466713_067964 | Ga0466713_067964_387_1418 | 343 |
| 95 | 3300042605 | Ga0466716_534970 | Ga0466716_534970_708_1742 | 344 |
| 96 | iso_pr_bacteria | 2695420317 | 2695485806 | 344 |
| 97 | iso_pr_bacteria | 2820751898 | 2820752673 | 344 |
| 98 | iso_pr_bacteria | 2820776227 | 2820776966 | 344 |
| 99 | iso_pr_bacteria | 2873600114 | 2873603568 | 344 |
| 100 | iso_pr_bacteria | 8100157865 | 8100161860 | 344 |
| 101 | 3300009784 | Ga0123357_10001395 | Ga0123357_100013952 | 345 |
| 102 | 3300042601 | Ga0466707_072578 | Ga0466707_072578_3592_4629 | 345 |
| 103 | 3300042608 | Ga0466721_113574 | Ga0466721_113574_28736_29773 | 345 |
| 104 | 3300042619 | Ga0466726_415435 | Ga0466726_415435_1054_2091 | 345 |
| 105 | iso_pr_bacteria | 3000153175 | 3000154192 | 345 |
| 106 | 3300003131 | Ga0052165_100012 | Ga0052165_1000125 | 346 |
| 107 | 3300042593 | Ga0466691_080715 | Ga0466691_080715_3333_4373 | 346 |
| 108 | 3300042624 | Ga0466735_060243 | Ga0466735_060243_3524_4564 | 346 |
| 109 | 3300042593 | Ga0466691_082749 | Ga0466691_082749_19130_20173 | 347 |
| 110 | 3300042609 | Ga0466722_187749 | Ga0466722_187749_6218_7261 | 347 |
| 111 | 3300042655 | Ga0466727_033699 | Ga0466727_033699_1510_2592 | 347 |
| 112 | 3300042591 | Ga0466692_089897 | Ga0466692_089897_680_1726 | 348 |
| 113 | 3300042599 | Ga0466706_168917 | Ga0466706_168917_4089_5135 | 348 |
| 114 | 3300042611 | Ga0466697_181224 | Ga0466697_181224_128_1174 | 348 |
| 115 | 3300042636 | Ga0466703_039977 | Ga0466703_039977_9551_10609 | 352 |
| 116 | 3300042609 | Ga0466722_037020 | Ga0466722_037020_4715_5776 | 353 |
| 117 | 3300042616 | Ga0466715_181634 | Ga0466715_181634_2863_3924 | 353 |
| 118 | 3300042616 | Ga0466715_046690 | Ga0466715_046690_44294_45364 | 356 |
| 119 | 3300042596 | Ga0466696_137717 | Ga0466696_137717_3060_4133 | 357 |
| 120 | 3300042606 | Ga0466719_180231 | Ga0466719_180231_1819_2892 | 357 |
| 121 | 3300042615 | Ga0466711_363285 | Ga0466711_363285_28445_29518 | 357 |
| 122 | 3300042618 | Ga0466723_120806 | Ga0466723_120806_4322_5395 | 357 |
| 123 | 3300042621 | Ga0466729_189926 | Ga0466729_189926_185_1258 | 357 |
| 124 | 3300042652 | Ga0466708_328768 | Ga0466708_328768_9656_10729 | 357 |
| 125 | 3300042590 | Ga0466690_103898 | Ga0466690_103898_1747_2829 | 360 |
| 126 | 3300042619 | Ga0466726_128363 | Ga0466726_128363_1622_2704 | 360 |
| 127 | 3300042643 | Ga0466704_120917 | Ga0466704_120917_5654_6736 | 360 |
| 128 | 2225789004 | 2227080794 | 2227454208 | 363 |
| 129 | 3300042612 | Ga0466705_465403 | Ga0466705_465403_26122_27213 | 363 |
| 130 | 3300042605 | Ga0466716_429486 | Ga0466716_429486_221_1315 | 364 |
| 131 | 3300000062 | IMNBL1DRAFT_c0000765 | IMNBL1DRAFT_000076520 | 367 |
| 132 | 3300042619 | Ga0466726_091831 | Ga0466726_091831_746_1885 | 379 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.86 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.