Protein Family IF08220

Metagenome Isolate
132 Members
61 Samples
114 Scaffolds
340.23 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_091831|Ga0466726_091831_746_1885
Length
379 aa
Sequence
LQQHRTSTLALSHIAYRKSHSRKKVLPLHPFFASLSSQEKNNILKTAVVILSWNGEKFLRQLLPTVVAHSADAQAEVVVADNGSTDGSVAFVRQALPQVRLVLLDRNYGFTGGYNRALASVDADYAVLLNSDVSVPQGWLQPLVAYMDAHPDTAACMPKILSFAQPTRFEYAGAAGGFIDILGYPFCRGRVLGTLEDDLGQYNDTREIFWATGACMLVRTALYKALGGLDDDFFAHMEEIDLCWRMKNAGYKIAYVGEASVLHVGGGTLPNNNPRKMFFNYRNNLLMLHKNLSPRLHLPVLALRFVLDWVSALAFALQLRFSFAAAVFKAHRAFFILKKGKRHAAQTQSLRRLTGVYCGSIVAAYFLRQRKTFNDLMKS

πŸ“Š Sample Types

Isolate 13.6%
Metagenome 86.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 25.4%
Kalotermitidae 23.7%
Unclassified 18.6%
Blattidae 8.5%
Rhinotermitidae 6.8%
Termopsidae 5.1%
Passalidae 3.4%
Pyroglyphidae 1.7%
Aphelinidae 1.7%
Hydrophilidae 1.7%
Delphacidae 1.7%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 132
Eukaryota 0
Viruses 0
Unclassified 0

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2920168565 Paludibacter sp. 221 Isolate Blattidae
2 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
3 3000153175 Cardinium endosymbiont of Dermatophagoides farinae UMMZ BMOC 05-0812-001 Isolate Pyroglyphidae
4 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
5 3300003131 Encarsia pergandiella symbiont microbial communities from Weslaco, Texas Metagenome Aphelinidae
6 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
7 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
8 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
9 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
10 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
11 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
12 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
13 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
14 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
15 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
16 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
17 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
18 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
19 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
20 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
21 2820767225 Unclassified Bacteroidetes Lab288P3bin34 Isolate Unclassified
22 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
23 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
24 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
25 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
26 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
27 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
28 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
29 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
30 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
31 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
32 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
33 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
34 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
35 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
36 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
37 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
38 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
39 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
40 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
41 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
42 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
43 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
44 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
45 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
46 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
47 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
48 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
49 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
50 3000336795 Cardinium endosymbiont of Sogatella furcifera cSfur Isolate Delphacidae
51 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
52 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
53 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
54 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
55 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
56 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
57 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
58 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
59 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
60 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
61 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466708_328768 3300042652 Bacteria 20898
2 Ga0466727_282261 3300042655 Bacteria 14300
3 Ga0466705_466695 3300042612 Bacteria 17364
4 Ga0466690_103898 3300042590 Bacteria 4389
5 Ga0466691_210405 3300042593 Bacteria 3921
6 Ga0466696_137717 3300042596 Bacteria 22521
7 2227080794 2225789004 Bacteria 41653
8 Ga0123356_10040726 3300010049 Bacteria 4328
9 Ga0123353_10395383 3300010167 Bacteria 2060
10 Ga0466706_048142 3300042599 Bacteria 37807
11 Ga0466719_180231 3300042606 Bacteria 22873
12 Ga0466703_356422 3300042636 Bacteria 3827
13 Ga0466704_486310 3300042643 Bacteria 39029
14 Ga0466708_128737 3300042652 Bacteria 11637
15 Ga0466708_148679 3300042652 Bacteria 8986
16 Ga0466711_517350 3300042615 Bacteria 1621
17 Ga0466715_383915 3300042616 Bacteria 3884
18 Ga0466726_185798 3300042619 Bacteria 2965
19 Ga0466726_415435 3300042619 Bacteria 2155
20 Ga0466728_008320 3300042620 Bacteria 7449
21 Ga0466729_029479 3300042621 Bacteria 4536
22 Ga0466692_089897 3300042591 Bacteria 3442
23 Ga0466691_082749 3300042593 Bacteria 46713
24 Ga0466696_007849 3300042596 Bacteria 54852
25 Ga0466696_120561 3300042596 Bacteria 43533
26 Ga0466696_227581 3300042596 Bacteria 20008
27 Ga0466733_031314 3300042659 Bacteria 5896
28 Ga0123356_10229811 3300010049 Bacteria 1918
29 Ga0123356_10533231 3300010049 Bacteria 1333
30 Ga0466700_084730 3300042600 Bacteria 2087
31 Ga0466713_020238 3300042602 Bacteria 5699
32 Ga0466714_155308 3300042603 Bacteria 2891
33 Ga0466714_157522 3300042603 Bacteria 5031
34 Ga0466721_113574 3300042608 Bacteria 34320
35 Ga0466722_144985 3300042609 Bacteria 6663
36 Ga0466722_187749 3300042609 Bacteria 12297
37 Ga0466735_005381 3300042624 Bacteria 2921
38 Ga0466735_060243 3300042624 Bacteria 5861
39 Ga0466735_128622 3300042624 Bacteria 3668
40 Ga0466703_115104 3300042636 Bacteria 5668
41 Ga0466727_033699 3300042655 Bacteria 3189
42 Ga0466715_045235 3300042616 Bacteria 6029
43 Ga0466723_093572 3300042618 Bacteria 20624
44 Ga0466690_027027 3300042590 Bacteria 9640
45 Ga0466696_289430 3300042596 Bacteria 8723
46 JGI24702J35022_10003442 3300002462 Bacteria 9533
47 Ga0466697_181224 3300042611 Bacteria 3059
48 Ga0123356_10002851 3300010049 Bacteria 18293
49 Ga0123353_10186629 3300010167 Bacteria 3278
50 Ga0466714_032508 3300042603 Bacteria 28301
51 Ga0466703_039977 3300042636 Bacteria 12863
52 Ga0466703_053718 3300042636 Bacteria 3003
53 Ga0466704_060132 3300042643 Bacteria 107799
54 Ga0466704_120917 3300042643 Bacteria 17399
55 Ga0466711_363285 3300042615 Bacteria 32228
56 Ga0466715_181634 3300042616 Bacteria 4275
57 Ga0466723_087794 3300042618 Bacteria 35967
58 Ga0466691_080715 3300042593 Bacteria 6729
59 Ga0466691_128965 3300042593 Bacteria 19997
60 IMNBL1DRAFT_c0000765 3300000062 Bacteria 25410
61 Ga0123356_10427829 3300010049 Bacteria 1467
62 Ga0466713_067964 3300042602 Bacteria 5715
63 Ga0466714_149913 3300042603 Bacteria 1308
64 Ga0466716_236813 3300042605 Bacteria 9488
65 Ga0466716_429486 3300042605 Bacteria 4941
66 Ga0466731_196277 3300042622 Bacteria 1495
67 Ga0466709_108564 3300042648 Bacteria 18399
68 Ga0466708_058687 3300042652 Bacteria 40531
69 Ga0466725_358109 3300042654 Bacteria 1793
70 Ga0466727_100048 3300042655 Bacteria 1988
71 Ga0466711_057204 3300042615 Bacteria 4437
72 Ga0466723_120806 3300042618 Bacteria 23212
73 Ga0466729_000478 3300042621 Bacteria 4830
74 Ga0466729_189926 3300042621 Bacteria 4935
75 Ga0052165_100012 3300003131 Bacteria 18596
76 Ga0466705_284351 3300042612 Bacteria 2513
77 Ga0123353_10087873 3300010167 Bacteria 5006
78 Ga0466706_168917 3300042599 Bacteria 75730
79 Ga0466706_196142 3300042599 Bacteria 22966
80 Ga0466719_228557 3300042606 Bacteria 4022
81 Ga0466722_037020 3300042609 Bacteria 9729
82 Ga0466703_381814 3300042636 Bacteria 6573
83 Ga0466705_465403 3300042612 Bacteria 32062
84 Ga0466723_065795 3300042618 Bacteria 9437
85 Ga0466726_091831 3300042619 Bacteria 2124
86 Ga0466728_240185 3300042620 Bacteria 6281
87 Ga0264413_154137 3300024493 Bacteria 2152
88 Ga0466657_244615 3300042582 Bacteria 77081
89 Ga0466690_088921 3300042590 Bacteria 12214
90 Ga0466691_162062 3300042593 Bacteria 7215
91 Ga0466696_035891 3300042596 Bacteria 6230
92 IMNBL1DRAFT_c0005358 3300000062 Bacteria 7363
93 JGI24705J35276_12238375 3300002504 Bacteria 20419
94 Ga0072941_1064385 3300005201 Bacteria 11729
95 Ga0123356_10659735 3300010049 Bacteria 1214
96 Ga0123353_10094803 3300010167 Bacteria 4809
97 Ga0466707_072578 3300042601 Bacteria 15033
98 Ga0466709_341543 3300042648 Bacteria 3881
99 Ga0466710_101979 3300042613 Bacteria 2942
100 Ga0466715_046690 3300042616 Bacteria 70037
101 Ga0466715_418895 3300042616 Bacteria 29319
102 Ga0466726_128363 3300042619 Bacteria 8103
103 Ga0466656_152874 3300042550 Bacteria 1370
104 Ga0466691_193575 3300042593 Bacteria 3456
105 Ga0466705_085149 3300042612 Bacteria 2989
106 Ga0466733_200504 3300042659 Bacteria 2552
107 Ga0466716_182998 3300042605 Bacteria 4401
108 Ga0466716_534970 3300042605 Bacteria 2917
109 Ga0466719_319408 3300042606 Bacteria 3991
110 Ga0466704_165836 3300042643 Bacteria 3374
111 Ga0466723_135338 3300042618 Bacteria 28340
112 IMNBL1DRAFT_c0026989 3300000062 Bacteria 2170
113 Ga0072941_1153157 3300005201 Bacteria 3468
114 Ga0123357_10001395 3300009784 Bacteria 25599

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042550 Ga0466656_152874 Ga0466656_152874_494_1327 277
2 3300042600 Ga0466700_084730 Ga0466700_084730_497_1399 300
3 3300042599 Ga0466706_196142 Ga0466706_196142_16650_17660 304
4 3300000062 IMNBL1DRAFT_c0005358 IMNBL1DRAFT_00053586 320
5 3300042612 Ga0466705_284351 Ga0466705_284351_1205_2230 325
6 3300042605 Ga0466716_182998 Ga0466716_182998_1326_2339 326
7 3300042624 Ga0466735_005381 Ga0466735_005381_1079_2101 326
8 3300042648 Ga0466709_341543 Ga0466709_341543_726_1733 326
9 3300010049 Ga0123356_10659735 Ga0123356_106597351 327
10 3300042643 Ga0466704_486310 Ga0466704_486310_30649_31668 327
11 3300010167 Ga0123353_10395383 Ga0123353_103953832 328
12 3300042596 Ga0466696_227581 Ga0466696_227581_160_1149 329
13 3300042636 Ga0466703_115104 Ga0466703_115104_2840_3862 329
14 3300042616 Ga0466715_383915 Ga0466715_383915_686_1699 330
15 3300042652 Ga0466708_128737 Ga0466708_128737_5937_6944 330
16 3300042655 Ga0466727_282261 Ga0466727_282261_4647_5642 331
17 3300042622 Ga0466731_196277 Ga0466731_196277_265_1299 334
18 3300042648 Ga0466709_108564 Ga0466709_108564_4720_5787 334
19 iso_pr_bacteria 2820748953 2820750247 334
20 3300002504 JGI24705J35276_12238375 JGI24705J35276_122383758 335
21 3300042596 Ga0466696_120561 Ga0466696_120561_12821_13828 335
22 3300042603 Ga0466714_155308 Ga0466714_155308_1788_2795 335
23 3300042616 Ga0466715_045235 Ga0466715_045235_695_1723 335
24 3300042616 Ga0466715_418895 Ga0466715_418895_24500_25507 335
25 3300042618 Ga0466723_087794 Ga0466723_087794_19772_20779 335
26 iso_pr_bacteria 3000336795 3000337346 335
27 3300005201 Ga0072941_1064385 Ga0072941_10643858 336
28 3300042593 Ga0466691_128965 Ga0466691_128965_4451_5461 336
29 3300042619 Ga0466726_185798 Ga0466726_185798_612_1622 336
30 3300042654 Ga0466725_358109 Ga0466725_358109_461_1471 336
31 3300042655 Ga0466727_100048 Ga0466727_100048_493_1503 336
32 3300042659 Ga0466733_200504 Ga0466733_200504_1076_2086 336
33 iso_pr_bacteria 2820767225 2820768103 336
34 iso_pr_bacteria 2820772500 2820773197 336
35 iso_pr_bacteria 2820781750 2820782138 336
36 3300005201 Ga0072941_1153157 Ga0072941_11531572 337
37 3300010049 Ga0123356_10002851 Ga0123356_100028511 337
38 3300010049 Ga0123356_10229811 Ga0123356_102298112 337
39 3300010049 Ga0123356_10533231 Ga0123356_105332311 337
40 3300010167 Ga0123353_10087873 Ga0123353_100878732 337
41 3300010167 Ga0123353_10186629 Ga0123353_101866291 337
42 3300024493 Ga0264413_154137 Ga0264413_1541371 337
43 3300042593 Ga0466691_193575 Ga0466691_193575_2165_3178 337
44 3300042593 Ga0466691_210405 Ga0466691_210405_2165_3178 337
45 3300042599 Ga0466706_048142 Ga0466706_048142_30728_31762 337
46 3300042603 Ga0466714_032508 Ga0466714_032508_2393_3457 337
47 3300042603 Ga0466714_157522 Ga0466714_157522_1194_2207 337
48 3300042606 Ga0466719_228557 Ga0466719_228557_148_1161 337
49 3300042620 Ga0466728_008320 Ga0466728_008320_6152_7165 337
50 3300042652 Ga0466708_148679 Ga0466708_148679_7450_8463 337
51 3300042659 Ga0466733_031314 Ga0466733_031314_921_1934 337
52 3300010049 Ga0123356_10427829 Ga0123356_104278292 338
53 3300010167 Ga0123353_10094803 Ga0123353_100948035 338
54 3300042590 Ga0466690_027027 Ga0466690_027027_8453_9469 338
55 3300042606 Ga0466719_319408 Ga0466719_319408_290_1306 338
56 3300042618 Ga0466723_093572 Ga0466723_093572_17683_18699 338
57 3300042620 Ga0466728_240185 Ga0466728_240185_4735_5751 338
58 3300042624 Ga0466735_128622 Ga0466735_128622_319_1335 338
59 3300042636 Ga0466703_381814 Ga0466703_381814_2299_3315 338
60 3300042643 Ga0466704_060132 Ga0466704_060132_20104_21120 338
61 3300042618 Ga0466723_065795 Ga0466723_065795_1377_2396 339
62 3300042618 Ga0466723_135338 Ga0466723_135338_11206_12225 339
63 3300042621 Ga0466729_000478 Ga0466729_000478_2993_4012 339
64 3300042621 Ga0466729_029479 Ga0466729_029479_229_1248 339
65 3300042636 Ga0466703_053718 Ga0466703_053718_326_1345 339
66 3300042636 Ga0466703_356422 Ga0466703_356422_1830_2849 339
67 3300042643 Ga0466704_165836 Ga0466704_165836_945_1988 339
68 3300042593 Ga0466691_162062 Ga0466691_162062_464_1486 340
69 3300042596 Ga0466696_035891 Ga0466696_035891_540_1562 340
70 3300042596 Ga0466696_289430 Ga0466696_289430_3391_4413 340
71 3300042612 Ga0466705_085149 Ga0466705_085149_1820_2863 340
72 3300042613 Ga0466710_101979 Ga0466710_101979_179_1201 340
73 3300042652 Ga0466708_058687 Ga0466708_058687_18455_19477 340
74 iso_pr_bacteria 2820736622 2820737504 340
75 iso_pr_bacteria 2820740053 2820741605 340
76 iso_pr_bacteria 2910949487 2910950988 340
77 3300002462 JGI24702J35022_10003442 JGI24702J35022_100034423 341
78 3300042603 Ga0466714_149913 Ga0466714_149913_80_1105 341
79 3300042612 Ga0466705_466695 Ga0466705_466695_12583_13608 341
80 iso_pr_bacteria 2910926975 2910929930 341
81 iso_pr_bacteria 2920168565 2920169971 341
82 iso_pr_bacteria 2940193328 2940194960 341
83 iso_pr_bacteria 2940336608 2940338246 341
84 3300000062 IMNBL1DRAFT_c0026989 IMNBL1DRAFT_00269892 342
85 3300010049 Ga0123356_10040726 Ga0123356_100407262 342
86 3300042582 Ga0466657_244615 Ga0466657_244615_13902_14930 342
87 3300042605 Ga0466716_236813 Ga0466716_236813_7735_8763 342
88 3300042609 Ga0466722_144985 Ga0466722_144985_2365_3393 342
89 3300042615 Ga0466711_057204 Ga0466711_057204_2073_3101 342
90 3300042615 Ga0466711_517350 Ga0466711_517350_38_1066 342
91 3300042590 Ga0466690_088921 Ga0466690_088921_4305_5336 343
92 3300042596 Ga0466696_007849 Ga0466696_007849_47351_48382 343
93 3300042602 Ga0466713_020238 Ga0466713_020238_3275_4306 343
94 3300042602 Ga0466713_067964 Ga0466713_067964_387_1418 343
95 3300042605 Ga0466716_534970 Ga0466716_534970_708_1742 344
96 iso_pr_bacteria 2695420317 2695485806 344
97 iso_pr_bacteria 2820751898 2820752673 344
98 iso_pr_bacteria 2820776227 2820776966 344
99 iso_pr_bacteria 2873600114 2873603568 344
100 iso_pr_bacteria 8100157865 8100161860 344
101 3300009784 Ga0123357_10001395 Ga0123357_100013952 345
102 3300042601 Ga0466707_072578 Ga0466707_072578_3592_4629 345
103 3300042608 Ga0466721_113574 Ga0466721_113574_28736_29773 345
104 3300042619 Ga0466726_415435 Ga0466726_415435_1054_2091 345
105 iso_pr_bacteria 3000153175 3000154192 345
106 3300003131 Ga0052165_100012 Ga0052165_1000125 346
107 3300042593 Ga0466691_080715 Ga0466691_080715_3333_4373 346
108 3300042624 Ga0466735_060243 Ga0466735_060243_3524_4564 346
109 3300042593 Ga0466691_082749 Ga0466691_082749_19130_20173 347
110 3300042609 Ga0466722_187749 Ga0466722_187749_6218_7261 347
111 3300042655 Ga0466727_033699 Ga0466727_033699_1510_2592 347
112 3300042591 Ga0466692_089897 Ga0466692_089897_680_1726 348
113 3300042599 Ga0466706_168917 Ga0466706_168917_4089_5135 348
114 3300042611 Ga0466697_181224 Ga0466697_181224_128_1174 348
115 3300042636 Ga0466703_039977 Ga0466703_039977_9551_10609 352
116 3300042609 Ga0466722_037020 Ga0466722_037020_4715_5776 353
117 3300042616 Ga0466715_181634 Ga0466715_181634_2863_3924 353
118 3300042616 Ga0466715_046690 Ga0466715_046690_44294_45364 356
119 3300042596 Ga0466696_137717 Ga0466696_137717_3060_4133 357
120 3300042606 Ga0466719_180231 Ga0466719_180231_1819_2892 357
121 3300042615 Ga0466711_363285 Ga0466711_363285_28445_29518 357
122 3300042618 Ga0466723_120806 Ga0466723_120806_4322_5395 357
123 3300042621 Ga0466729_189926 Ga0466729_189926_185_1258 357
124 3300042652 Ga0466708_328768 Ga0466708_328768_9656_10729 357
125 3300042590 Ga0466690_103898 Ga0466690_103898_1747_2829 360
126 3300042619 Ga0466726_128363 Ga0466726_128363_1622_2704 360
127 3300042643 Ga0466704_120917 Ga0466704_120917_5654_6736 360
128 2225789004 2227080794 2227454208 363
129 3300042612 Ga0466705_465403 Ga0466705_465403_26122_27213 363
130 3300042605 Ga0466716_429486 Ga0466716_429486_221_1315 364
131 3300000062 IMNBL1DRAFT_c0000765 IMNBL1DRAFT_000076520 367
132 3300042619 Ga0466726_091831 Ga0466726_091831_746_1885 379

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00535 Glycos_transf_2 Glycosyl transferase family 2 48 224 0.88
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 46 264 0.78

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.