Protein Family IF08214

Metagenome Isolate
129 Members
34 Samples
126 Scaffolds
324.15 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_076936|Ga0466726_076936_334_1476
Length
380 aa
Sequence
MIDLSNQKTGKMAIAASMHFEFCPAAFKHGITEASIRYAFLNPLFDGPTDHLTGEPILISIENMSDNNAEFLILGAGPAGLSAAQYGARANLKVLVVEQMAPGGQALTIDVLENYPGNVARGDTPPLTGFEFSQDLHRQAETFGARFIMEGAAGIAREGDSFVVNLSGGTTLRAPALLLASGALRRKLDVPGETEWYGRGVSYCATCDGPFFKGKRILVVGGGDAACDEAQYLSRLSDKVILVHRKSMFRAQKSLAERTLANPHIEVRFNTRLLEIKGDKKVASVLLEGPRDGGEIIPYEESIDAVFIFAGSTPQSVLAKDLGVKLDEAGYVITDQAMATSVRGFFAAGDVRSSPFRQVVVAAGEGAIAAHCAAEYISSL

📊 Sample Types

Isolate 2.3%
Metagenome 97.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 43.8%
Termitidae 28.1%
Rhinotermitidae 9.4%
Unclassified 9.4%
Termopsidae 9.4%

🌳 Taxonomy

Archaea 0
Bacteria 126
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
4 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
5 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
6 650716102 Treponema primitia ZAS-2 Isolate Unclassified
7 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
8 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
9 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
10 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
11 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
12 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
13 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
16 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
17 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
18 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
19 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
20 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
21 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
22 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
23 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
24 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
25 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
26 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
27 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
28 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
29 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
30 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
33 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
34 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_337054 3300042612 Bacteria 1953
2 Ga0466711_306143 3300042615 Bacteria 4346
3 Ga0466718_029946 3300042617 Bacteria 5031
4 Ga0466723_116947 3300042618 Bacteria 88879
5 Ga0466723_359994 3300042618 Bacteria 11936
6 Ga0466690_406218 3300042590 Bacteria 4406
7 Ga0466696_034159 3300042596 Bacteria 13370
8 Ga0466716_088306 3300042605 Bacteria 10529
9 Ga0466719_052414 3300042606 Bacteria 13658
10 Ga0466735_144318 3300042624 Bacteria 1302
11 Ga0466704_018469 3300042643 Bacteria 1254
12 Ga0466704_169836 3300042643 Bacteria 5526
13 Ga0466704_533080 3300042643 Bacteria 39781
14 Ga0466709_013258 3300042648 Unclassified 5342
15 Ga0466709_057755 3300042648 Bacteria 7617
16 Ga0466708_035859 3300042652 Bacteria 41234
17 Ga0466708_094415 3300042652 Bacteria 8131
18 Ga0466708_368162 3300042652 Bacteria 11090
19 Ga0123353_10297256 3300010167 Bacteria 2468
20 Ga0466715_316742 3300042616 Bacteria 5931
21 Ga0466726_421378 3300042619 Bacteria 1045
22 Ga0264413_118048 3300024493 Bacteria 1698
23 Ga0466696_006315 3300042596 Bacteria 5215
24 Ga0466696_037428 3300042596 Bacteria 12157
25 Ga0072940_1057983 3300005200 Bacteria 1893
26 Ga0072940_1067237 3300005200 Bacteria 3535
27 Ga0466722_162417 3300042609 Bacteria 9035
28 Ga0466722_189156 3300042609 Bacteria 5236
29 Ga0466703_329467 3300042636 Bacteria 6198
30 Ga0466704_158088 3300042643 Bacteria 7308
31 Ga0466708_083826 3300042652 Bacteria 27482
32 Ga0466727_166146 3300042655 Bacteria 11481
33 Ga0466727_310191 3300042655 Bacteria 4465
34 Ga0466727_344691 3300042655 Bacteria 1284
35 Ga0466711_222607 3300042615 Bacteria 5235
36 Ga0466715_153644 3300042616 Bacteria 3920
37 Ga0466715_316046 3300042616 Bacteria 4057
38 Ga0466718_063583 3300042617 Bacteria 6793
39 Ga0466718_151555 3300042617 Bacteria 17973
40 Ga0466718_155839 3300042617 Bacteria 14999
41 Ga0466690_285642 3300042590 Unclassified 16061
42 Ga0466696_389043 3300042596 Bacteria 1347
43 JGI24698J34947_10105744 3300002449 Bacteria 1254
44 Ga0072941_1091121 3300005201 Bacteria 2195
45 Ga0466716_012013 3300042605 Bacteria 1698
46 Ga0466722_128753 3300042609 Bacteria 10433
47 Ga0466722_154024 3300042609 Bacteria 20907
48 Ga0466709_404832 3300042648 Bacteria 1442
49 Ga0466705_318964 3300042612 Bacteria 2876
50 Ga0466711_099590 3300042615 Bacteria 3069
51 Ga0466715_260645 3300042616 Bacteria 28966
52 Ga0466718_157935 3300042617 Bacteria 7797
53 Ga0466723_026309 3300042618 Bacteria 18891
54 Ga0466723_065503 3300042618 Bacteria 10421
55 Ga0456237_0002633 3300041968 Bacteria 2899
56 Ga0466691_035009 3300042593 Bacteria 9097
57 Ga0466691_104347 3300042593 Bacteria 19831
58 Ga0466691_223366 3300042593 Bacteria 12376
59 Ga0466696_179235 3300042596 Bacteria 7060
60 Ga0466716_035400 3300042605 Bacteria 6562
61 Ga0466719_454107 3300042606 Bacteria 3392
62 Ga0466722_135944 3300042609 Bacteria 1273
63 Ga0466703_192749 3300042636 Bacteria 5755
64 Ga0466703_270247 3300042636 Bacteria 9958
65 Ga0466704_067158 3300042643 Bacteria 9669
66 Ga0466727_139887 3300042655 Bacteria 1528
67 Ga0466711_233902 3300042615 Bacteria 21769
68 Ga0466711_393717 3300042615 Bacteria 9538
69 Ga0466718_055146 3300042617 Bacteria 2232
70 Ga0466728_122820 3300042620 Bacteria 13543
71 Ga0466690_219161 3300042590 Bacteria 5975
72 Ga0466691_045852 3300042593 Bacteria 2095
73 AustNasuHG_c1005672 3300000089 Bacteria 4466
74 Ga0072941_1012693 3300005201 Bacteria 23974
75 Ga0466708_035814 3300042652 Bacteria 4726
76 Ga0466708_369443 3300042652 Bacteria 17120
77 Ga0466711_087762 3300042615 Bacteria 4533
78 Ga0466723_035249 3300042618 Bacteria 15913
79 Ga0466723_210854 3300042618 Bacteria 1967
80 Ga0466726_251417 3300042619 Bacteria 1995
81 Ga0466690_229942 3300042590 Bacteria 13697
82 Ga0466692_061766 3300042591 Bacteria 11909
83 Ga0466691_031667 3300042593 Bacteria 7103
84 Ga0466696_026868 3300042596 Bacteria 8813
85 Ga0466699_329736 3300042597 Bacteria 1231
86 Ga0072941_1000180 3300005201 Bacteria 54954
87 Ga0466722_072741 3300042609 Bacteria 2661
88 Ga0466722_196308 3300042609 Bacteria 30459
89 Ga0466703_191246 3300042636 Bacteria 6355
90 Ga0466704_022603 3300042643 Bacteria 6714
91 Ga0466704_081390 3300042643 Bacteria 8258
92 Ga0466709_009016 3300042648 Bacteria 9546
93 Ga0466709_019236 3300042648 Bacteria 18315
94 Ga0466705_019379 3300042612 Bacteria 5260
95 Ga0466718_026586 3300042617 Bacteria 13284
96 Ga0466718_127721 3300042617 Bacteria 5623
97 Ga0466723_128030 3300042618 Bacteria 26554
98 Ga0466723_353380 3300042618 Bacteria 2122
99 Ga0466726_076936 3300042619 Bacteria 2080
100 Ga0072941_1000038 3300005201 Bacteria 14911
101 Ga0072941_1001002 3300005201 Bacteria 23705
102 Ga0466716_087969 3300042605 Bacteria 4182
103 Ga0466716_093477 3300042605 Bacteria 8098
104 Ga0466719_128996 3300042606 Bacteria 1442
105 Ga0466698_295445 3300042610 Bacteria 2764
106 Ga0466702_240224 3300042635 Bacteria 13531
107 Ga0466703_062086 3300042636 Bacteria 35310
108 Ga0466708_083140 3300042652 Bacteria 34789
109 Ga0466727_258137 3300042655 Bacteria 3144
110 Ga0466705_168935 3300042612 Bacteria 6471
111 Ga0466732_178490 3300042656 Bacteria 1544
112 Ga0466711_473947 3300042615 Bacteria 2589
113 Ga0466715_335419 3300042616 Bacteria 4022
114 Ga0466718_053065 3300042617 Bacteria 2019
115 Ga0466723_034802 3300042618 Bacteria 4711
116 Ga0466723_140724 3300042618 Bacteria 42677
117 Ga0466728_090500 3300042620 Bacteria 15311
118 Ga0466728_311772 3300042620 Bacteria 5159
119 Ga0466692_069882 3300042591 Bacteria 61867
120 Ga0466696_235028 3300042596 Bacteria 15062
121 Ga0466716_143028 3300042605 Bacteria 1938
122 Ga0466719_053337 3300042606 Unclassified 8845
123 Ga0466719_266929 3300042606 Bacteria 24531
124 Ga0466698_476948 3300042610 Bacteria 1779
125 Ga0466709_270765 3300042648 Bacteria 11257
126 Ga0466727_049560 3300042655 Bacteria 1389

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_018469 Ga0466704_018469_435_1226 263
2 3300042609 Ga0466722_162417 Ga0466722_162417_2618_3469 283
3 3300042643 Ga0466704_533080 Ga0466704_533080_29881_30819 292
4 3300042605 Ga0466716_143028 Ga0466716_143028_813_1694 293
5 3300024493 Ga0264413_118048 Ga0264413_1180481 297
6 3300042606 Ga0466719_128996 Ga0466719_128996_432_1334 300
7 3300005200 Ga0072940_1057983 Ga0072940_10579831 303
8 3300041968 Ga0456237_0002633 Ga0456237_0002633_126_1082 304
9 3300042593 Ga0466691_223366 Ga0466691_223366_459_1409 307
10 3300042615 Ga0466711_222607 Ga0466711_222607_3425_4351 308
11 iso_pr_bacteria 650716102 650881027 308
12 3300042590 Ga0466690_285642 Ga0466690_285642_10842_11825 309
13 3300042624 Ga0466735_144318 Ga0466735_144318_11_943 310
14 3300042609 Ga0466722_189156 Ga0466722_189156_1102_2037 311
15 3300042590 Ga0466690_229942 Ga0466690_229942_8357_9295 312
16 3300042612 Ga0466705_019379 Ga0466705_019379_3676_4614 312
17 3300042618 Ga0466723_128030 Ga0466723_128030_110_1132 312
18 3300042618 Ga0466723_140724 Ga0466723_140724_26869_27807 312
19 3300042636 Ga0466703_191246 Ga0466703_191246_5131_6069 312
20 3300042655 Ga0466727_344691 Ga0466727_344691_289_1227 312
21 3300042635 Ga0466702_240224 Ga0466702_240224_4572_5513 313
22 3300042652 Ga0466708_083826 Ga0466708_083826_11167_12108 313
23 3300042610 Ga0466698_295445 Ga0466698_295445_1541_2485 314
24 3300042656 Ga0466732_178490 Ga0466732_178490_347_1291 314
25 3300042596 Ga0466696_026868 Ga0466696_026868_5162_6109 315
26 3300005201 Ga0072941_1000038 Ga0072941_10000385 317
27 3300042606 Ga0466719_052414 Ga0466719_052414_8043_8996 317
28 3300042615 Ga0466711_099590 Ga0466711_099590_302_1255 317
29 3300042620 Ga0466728_090500 Ga0466728_090500_3516_4469 317
30 3300042636 Ga0466703_192749 Ga0466703_192749_4559_5512 317
31 3300042590 Ga0466690_406218 Ga0466690_406218_572_1528 318
32 3300042596 Ga0466696_037428 Ga0466696_037428_4211_5167 318
33 3300042606 Ga0466719_053337 Ga0466719_053337_5476_6432 318
34 3300042606 Ga0466719_266929 Ga0466719_266929_2349_3305 318
35 3300042609 Ga0466722_135944 Ga0466722_135944_160_1116 318
36 3300042615 Ga0466711_233902 Ga0466711_233902_10417_11394 318
37 3300042618 Ga0466723_116947 Ga0466723_116947_80937_81893 318
38 3300042648 Ga0466709_270765 Ga0466709_270765_7415_8371 318
39 3300042652 Ga0466708_094415 Ga0466708_094415_5979_6998 318
40 3300042617 Ga0466718_151555 Ga0466718_151555_4286_5245 319
41 3300042620 Ga0466728_122820 Ga0466728_122820_3446_4405 319
42 3300042655 Ga0466727_258137 Ga0466727_258137_1811_2785 319
43 3300042597 Ga0466699_329736 Ga0466699_329736_87_1049 320
44 3300042617 Ga0466718_155839 Ga0466718_155839_12267_13229 320
45 iso_pr_bacteria 2781125661 2781332690 320
46 3300042596 Ga0466696_389043 Ga0466696_389043_209_1174 321
47 3300042612 Ga0466705_337054 Ga0466705_337054_355_1320 321
48 3300042636 Ga0466703_329467 Ga0466703_329467_2760_3725 321
49 3300042643 Ga0466704_169836 Ga0466704_169836_2988_3953 321
50 3300042596 Ga0466696_006315 Ga0466696_006315_851_1819 322
51 3300042605 Ga0466716_093477 Ga0466716_093477_5165_6175 322
52 3300042612 Ga0466705_318964 Ga0466705_318964_237_1220 322
53 3300042615 Ga0466711_087762 Ga0466711_087762_2605_3573 322
54 3300042616 Ga0466715_260645 Ga0466715_260645_11170_12153 322
55 3300042618 Ga0466723_353380 Ga0466723_353380_446_1414 322
56 3300042652 Ga0466708_035859 Ga0466708_035859_35793_36761 322
57 3300042655 Ga0466727_049560 Ga0466727_049560_187_1155 322
58 3300010167 Ga0123353_10297256 Ga0123353_102972562 323
59 3300042605 Ga0466716_088306 Ga0466716_088306_2820_3791 323
60 3300042606 Ga0466719_454107 Ga0466719_454107_326_1297 323
61 3300042616 Ga0466715_316046 Ga0466715_316046_476_1447 323
62 3300042617 Ga0466718_026586 Ga0466718_026586_8657_9628 323
63 3300042617 Ga0466718_053065 Ga0466718_053065_310_1281 323
64 3300042617 Ga0466718_127721 Ga0466718_127721_3779_4750 323
65 3300042618 Ga0466723_065503 Ga0466723_065503_7763_8734 323
66 3300042619 Ga0466726_421378 Ga0466726_421378_62_1033 323
67 3300042655 Ga0466727_310191 Ga0466727_310191_2568_3539 323
68 3300002449 JGI24698J34947_10105744 JGI24698J34947_101057442 324
69 3300042605 Ga0466716_087969 Ga0466716_087969_2774_3748 324
70 3300042612 Ga0466705_168935 Ga0466705_168935_3473_4447 324
71 3300042618 Ga0466723_035249 Ga0466723_035249_2079_3053 324
72 3300042643 Ga0466704_022603 Ga0466704_022603_2772_3749 325
73 3300042652 Ga0466708_369443 Ga0466708_369443_13819_14796 325
74 3300042593 Ga0466691_031667 Ga0466691_031667_2042_3025 327
75 3300042596 Ga0466696_179235 Ga0466696_179235_5689_6672 327
76 3300042615 Ga0466711_473947 Ga0466711_473947_822_1805 327
77 3300042616 Ga0466715_153644 Ga0466715_153644_2463_3446 327
78 3300042616 Ga0466715_335419 Ga0466715_335419_2439_3422 327
79 3300042618 Ga0466723_034802 Ga0466723_034802_794_1777 327
80 3300042618 Ga0466723_210854 Ga0466723_210854_623_1606 327
81 3300042643 Ga0466704_067158 Ga0466704_067158_7380_8363 327
82 3300042648 Ga0466709_019236 Ga0466709_019236_3991_4974 327
83 3300042655 Ga0466727_166146 Ga0466727_166146_1559_2542 327
84 3300000089 AustNasuHG_c1005672 AustNasuHG_10056723 328
85 3300005200 Ga0072940_1067237 Ga0072940_10672373 328
86 3300042615 Ga0466711_306143 Ga0466711_306143_3342_4328 328
87 3300042619 Ga0466726_251417 Ga0466726_251417_32_1033 328
88 3300042643 Ga0466704_081390 Ga0466704_081390_975_1976 328
89 3300042655 Ga0466727_139887 Ga0466727_139887_485_1486 328
90 3300005201 Ga0072941_1091121 Ga0072941_10911212 329
91 3300042648 Ga0466709_013258 Ga0466709_013258_3724_4713 329
92 3300042620 Ga0466728_311772 Ga0466728_311772_489_1481 330
93 3300042648 Ga0466709_009016 Ga0466709_009016_6113_7105 330
94 3300042593 Ga0466691_104347 Ga0466691_104347_11419_12435 331
95 3300042596 Ga0466696_235028 Ga0466696_235028_5108_6103 331
96 3300042609 Ga0466722_072741 Ga0466722_072741_793_1788 331
97 3300042636 Ga0466703_270247 Ga0466703_270247_8516_9511 331
98 3300042648 Ga0466709_404832 Ga0466709_404832_181_1176 331
99 3300042652 Ga0466708_083140 Ga0466708_083140_7520_8515 331
100 3300042609 Ga0466722_154024 Ga0466722_154024_4739_5737 332
101 3300042610 Ga0466698_476948 Ga0466698_476948_316_1314 332
102 3300042596 Ga0466696_034159 Ga0466696_034159_10135_11136 333
103 3300042605 Ga0466716_035400 Ga0466716_035400_5284_6300 333
104 3300042615 Ga0466711_393717 Ga0466711_393717_115_1116 333
105 3300042590 Ga0466690_219161 Ga0466690_219161_313_1332 334
106 3300042593 Ga0466691_045852 Ga0466691_045852_296_1378 334
107 3300042609 Ga0466722_196308 Ga0466722_196308_8776_9780 334
108 3300042617 Ga0466718_063583 Ga0466718_063583_2150_3154 334
109 3300042618 Ga0466723_359994 Ga0466723_359994_8665_9738 334
110 3300042652 Ga0466708_368162 Ga0466708_368162_3547_4554 335
111 3300005201 Ga0072941_1012693 Ga0072941_101269320 336
112 3300042652 Ga0466708_035814 Ga0466708_035814_926_1972 336
113 iso_pr_bacteria 2772190978 2773730012 337
114 3300005201 Ga0072941_1000180 Ga0072941_10001803 338
115 3300042591 Ga0466692_061766 Ga0466692_061766_3854_4870 338
116 3300005201 Ga0072941_1001002 Ga0072941_10010026 339
117 3300042618 Ga0466723_026309 Ga0466723_026309_6489_7526 340
118 3300042643 Ga0466704_158088 Ga0466704_158088_2786_3808 340
119 3300042617 Ga0466718_029946 Ga0466718_029946_3575_4600 341
120 3300042636 Ga0466703_062086 Ga0466703_062086_18754_19782 342
121 3300042593 Ga0466691_035009 Ga0466691_035009_6281_7315 344
122 3300042648 Ga0466709_057755 Ga0466709_057755_3947_4984 345
123 3300042605 Ga0466716_012013 Ga0466716_012013_219_1262 347
124 3300042616 Ga0466715_316742 Ga0466715_316742_1516_2559 347
125 3300042591 Ga0466692_069882 Ga0466692_069882_4812_5882 356
126 3300042617 Ga0466718_055146 Ga0466718_055146_853_1923 356
127 3300042617 Ga0466718_157935 Ga0466718_157935_3191_4261 356
128 3300042609 Ga0466722_128753 Ga0466722_128753_5917_6993 358
129 3300042619 Ga0466726_076936 Ga0466726_076936_334_1476 380

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 216 288 0.92
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 72 366 0.9
PF01946 Thi4 Thi4 family 69 105 0.87
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 73 117 0.85
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 154 349 0.77

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF07992 GO:0016491 oxidoreductase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.