Protein Family IF08212

Metagenome Isolate
128 Members
44 Samples
125 Scaffolds
260.29 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_069480|Ga0466726_069480_9791_10660
Length
289 aa
Sequence
MRTGTTNDDSEECPGKKGVFMAATPQDIITAKLFFNAAFPVMKVVLEDDPAMKAKFQDVKAVVQIGAKNPGGNGGEEFLACHLVFNKGEFQVILGPAEKPDIVLSFPTVAKMNTMFRGGAALPAIKGFGKLGLLLKVFSLLMSLMIMMPGSRPKDPVKRRLKVKMSLYMVSRALSVYNKLGNPEMAEWCKRQPDRIYQFVVDKPGSSEPEIACYLRVKAGKSKSGHGVYARRRPFVLFHFFNVDGALKVLLKDVGFVQGVEEGCVEVVGSPEYAMNLNDFMAILQGMLT

📊 Sample Types

Isolate 2.3%
Metagenome 97.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.9%
Kalotermitidae 31.8%
Unclassified 13.6%
Termopsidae 6.8%
Rhinotermitidae 4.5%
Hodotermitidae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 105
Eukaryota 0
Viruses 0
Unclassified 23

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
9 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
12 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
13 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
14 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
15 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
18 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
23 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
24 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
25 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
26 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
27 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
28 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
29 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
30 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
31 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
32 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
33 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
34 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
35 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
36 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
37 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
38 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
39 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
40 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
41 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
42 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
43 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
44 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466716_100842 3300042605 Bacteria 3843
2 Ga0415639_038845 3300038395 Bacteria 2736
3 Ga0466693_358918 3300042592 Unclassified 1769
4 Ga0466691_115443 3300042593 Bacteria 13963
5 Ga0466699_202301 3300042597 Unclassified 1151
6 Ga0466711_195788 3300042615 Bacteria 43179
7 Ga0466735_014604 3300042624 Bacteria 2326
8 Ga0466709_258735 3300042648 Bacteria 25998
9 Ga0123353_10824501 3300010167 Unclassified 1276
10 Ga0123353_10910514 3300010167 Bacteria 1196
11 Ga0466717_084737 3300042604 Unclassified 1562
12 Ga0466716_055043 3300042605 Bacteria 7503
13 Ga0466691_102941 3300042593 Bacteria 2766
14 Ga0466691_186489 3300042593 Unclassified 3511
15 Ga0466694_354300 3300042594 Unclassified 1024
16 AustNasuHG_c1003344 3300000089 Bacteria 5789
17 JGI24695J34938_10006985 3300002450 Bacteria 6691
18 JGI24705J35276_12221881 3300002504 Bacteria 2375
19 Ga0466711_391543 3300042615 Bacteria 1720
20 Ga0466718_091528 3300042617 Bacteria 1689
21 Ga0466718_123069 3300042617 Bacteria 3075
22 Ga0466723_085947 3300042618 Bacteria 4622
23 Ga0466708_463540 3300042652 Bacteria 1447
24 Ga0123353_10311267 3300010167 Bacteria 2396
25 Ga0466716_311125 3300042605 Bacteria 3983
26 Ga0466719_052505 3300042606 Bacteria 2406
27 Ga0466722_181203 3300042609 Bacteria 46889
28 Ga0466690_425403 3300042590 Unclassified 1166
29 Ga0466695_280829 3300042595 Bacteria 2401
30 JGI24702J35022_10179995 3300002462 Unclassified 1200
31 Ga0466732_038600 3300042656 Bacteria 2766
32 Ga0466705_410542 3300042612 Bacteria 3038
33 Ga0466712_005251 3300042614 Bacteria 6040
34 Ga0466711_077314 3300042615 Bacteria 6016
35 Ga0466715_063064 3300042616 Bacteria 2589
36 Ga0466726_069480 3300042619 Bacteria 23044
37 Ga0466704_028477 3300042643 Bacteria 15476
38 Ga0466704_594897 3300042643 Bacteria 5615
39 Ga0466709_193050 3300042648 Bacteria 5694
40 Ga0123356_10546428 3300010049 Bacteria 1319
41 Ga0123353_10118256 3300010167 Bacteria 4262
42 Ga0123353_10646094 3300010167 Bacteria 1499
43 Ga0466716_067556 3300042605 Bacteria 9999
44 Ga0466719_039352 3300042606 Bacteria 19876
45 Ga0466690_232729 3300042590 Bacteria 4653
46 Ga0466692_180232 3300042591 Bacteria 17562
47 Ga0466695_367109 3300042595 Bacteria 3109
48 JGI24702J35022_10006608 3300002462 Bacteria 6696
49 JGI24702J35022_10124453 3300002462 Bacteria 1426
50 Ga0466715_061446 3300042616 Bacteria 3089
51 Ga0466723_043166 3300042618 Bacteria 9301
52 Ga0466703_192023 3300042636 Bacteria 1677
53 Ga0466704_097597 3300042643 Bacteria 2251
54 Ga0466704_227433 3300042643 Bacteria 15202
55 Ga0466709_102081 3300042648 Bacteria 3753
56 Ga0466708_204688 3300042652 Unclassified 3887
57 Ga0123356_10000331 3300010049 Bacteria 54509
58 Ga0123356_10718413 3300010049 Bacteria 1168
59 Ga0123353_10262731 3300010167 Bacteria 2665
60 Ga0123353_10619721 3300010167 Bacteria 1541
61 Ga0466700_255941 3300042600 Bacteria 2452
62 Ga0466722_049863 3300042609 Bacteria 3533
63 Ga0466722_124768 3300042609 Bacteria 11230
64 Ga0466698_240409 3300042610 Unclassified 1245
65 Ga0415639_114175 3300038395 Bacteria 1810
66 Ga0466691_067175 3300042593 Bacteria 9703
67 Ga0466691_128820 3300042593 Bacteria 5000
68 Ga0466696_266448 3300042596 Bacteria 23351
69 JGI24698J34947_10002698 3300002449 Bacteria 9577
70 JGI24702J35022_10059845 3300002462 Unclassified 2035
71 Ga0466711_120404 3300042615 Bacteria 15432
72 Ga0466715_136168 3300042616 Bacteria 23992
73 Ga0466723_050995 3300042618 Bacteria 2831
74 Ga0466703_188982 3300042636 Unclassified 1846
75 Ga0123356_10038918 3300010049 Bacteria 4431
76 Ga0123353_10229668 3300010167 Unclassified 2894
77 Ga0466713_139080 3300042602 Bacteria 2141
78 Ga0466713_155128 3300042602 Bacteria 4770
79 Ga0466716_401828 3300042605 Bacteria 4088
80 Ga0466692_142303 3300042591 Bacteria 11124
81 JGI24702J35022_10008569 3300002462 Bacteria 5786
82 JGI24702J35022_10098944 3300002462 Unclassified 1595
83 Ga0466715_151762 3300042616 Bacteria 3926
84 Ga0466715_349008 3300042616 Bacteria 9436
85 Ga0466726_017488 3300042619 Bacteria 13070
86 Ga0466705_278583 3300042612 Bacteria 19732
87 Ga0466703_142608 3300042636 Bacteria 3498
88 Ga0466703_389486 3300042636 Bacteria 5771
89 Ga0123353_10962299 3300010167 Bacteria 1153
90 Ga0466707_015357 3300042601 Bacteria 1778
91 Ga0466716_063828 3300042605 Bacteria 8565
92 Ga0466690_009121 3300042590 Bacteria 15585
93 Ga0466692_028867 3300042591 Bacteria 7409
94 Ga0466696_010817 3300042596 Bacteria 8867
95 Ga0466696_011364 3300042596 Bacteria 2550
96 JGI24702J35022_10010554 3300002462 Bacteria 5158
97 JGI24702J35022_10053145 3300002462 Unclassified 2160
98 Ga0068305_10003725 3300005083 Bacteria 4525
99 Ga0466712_013711 3300042614 Unclassified 1209
100 Ga0466726_072398 3300042619 Unclassified 2471
101 Ga0466728_417071 3300042620 Bacteria 5139
102 Ga0466705_111372 3300042612 Unclassified 7889
103 Ga0466703_109964 3300042636 Bacteria 17314
104 Ga0466708_194271 3300042652 Unclassified 1556
105 Ga0123353_10043080 3300010167 Bacteria 7148
106 Ga0466706_018505 3300042599 Unclassified 1164
107 Ga0466706_075389 3300042599 Bacteria 11175
108 Ga0466707_409800 3300042601 Bacteria 2051
109 Ga0466713_148635 3300042602 Bacteria 2378
110 Ga0466719_498156 3300042606 Bacteria 69594
111 Ga0466690_189918 3300042590 Bacteria 9315
112 Ga0466691_004379 3300042593 Bacteria 27826
113 Ga0466696_189438 3300042596 Unclassified 24789
114 JGI24702J35022_10010186 3300002462 Bacteria 5264
115 Ga0466711_011926 3300042615 Bacteria 2651
116 Ga0466711_324323 3300042615 Bacteria 4705
117 Ga0466715_000382 3300042616 Bacteria 6068
118 Ga0466715_458818 3300042616 Unclassified 3210
119 Ga0466723_023716 3300042618 Bacteria 23982
120 Ga0466723_029142 3300042618 Bacteria 3622
121 Ga0466728_011064 3300042620 Bacteria 2837
122 Ga0466705_172961 3300042612 Bacteria 2169
123 Ga0466705_179579 3300042612 Bacteria 4282
124 Ga0466708_021866 3300042652 Bacteria 13432
125 Ga0466727_236378 3300042655 Unclassified 6530

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002462 JGI24702J35022_10124453 JGI24702J35022_101244531 233
2 3300002462 JGI24702J35022_10179995 JGI24702J35022_101799951 233
3 3300042652 Ga0466708_194271 Ga0466708_194271_447_1232 237
4 3300002462 JGI24702J35022_10059845 JGI24702J35022_100598453 238
5 3300002504 JGI24705J35276_12221881 JGI24705J35276_122218812 238
6 3300002462 JGI24702J35022_10006608 JGI24702J35022_100066088 239
7 3300010167 Ga0123353_10118256 Ga0123353_101182563 239
8 3300042590 Ga0466690_232729 Ga0466690_232729_1347_2132 240
9 3300010167 Ga0123353_10824501 Ga0123353_108245012 241
10 3300042600 Ga0466700_255941 Ga0466700_255941_1521_2321 241
11 3300042614 Ga0466712_013711 Ga0466712_013711_339_1139 243
12 3300000089 AustNasuHG_c1003344 AustNasuHG_10033442 244
13 3300042591 Ga0466692_142303 Ga0466692_142303_2181_2984 244
14 3300042619 Ga0466726_017488 Ga0466726_017488_10620_11429 244
15 3300042652 Ga0466708_204688 Ga0466708_204688_1881_2615 244
16 3300042601 Ga0466707_409800 Ga0466707_409800_580_1371 245
17 3300010167 Ga0123353_10043080 Ga0123353_100430802 246
18 3300042618 Ga0466723_085947 Ga0466723_085947_3809_4585 246
19 3300042636 Ga0466703_142608 Ga0466703_142608_2480_3265 247
20 3300042597 Ga0466699_202301 Ga0466699_202301_42_860 248
21 3300042616 Ga0466715_458818 Ga0466715_458818_502_1248 248
22 3300042604 Ga0466717_084737 Ga0466717_084737_346_1149 250
23 3300042612 Ga0466705_278583 Ga0466705_278583_10058_10873 250
24 3300042612 Ga0466705_410542 Ga0466705_410542_1845_2654 250
25 3300042616 Ga0466715_151762 Ga0466715_151762_970_1785 250
26 3300010167 Ga0123353_10229668 Ga0123353_102296683 251
27 3300038395 Ga0415639_114175 Ga0415639_114175_897_1661 254
28 3300042591 Ga0466692_180232 Ga0466692_180232_7916_8719 254
29 3300042593 Ga0466691_004379 Ga0466691_004379_1736_2521 254
30 3300010167 Ga0123353_10646094 Ga0123353_106460941 255
31 3300010167 Ga0123353_10962299 Ga0123353_109622992 255
32 3300042590 Ga0466690_189918 Ga0466690_189918_3422_4189 255
33 3300042615 Ga0466711_324323 Ga0466711_324323_1773_2540 255
34 3300042596 Ga0466696_011364 Ga0466696_011364_546_1319 257
35 3300042605 Ga0466716_055043 Ga0466716_055043_5912_6685 257
36 3300042605 Ga0466716_067556 Ga0466716_067556_39_812 257
37 3300042606 Ga0466719_039352 Ga0466719_039352_16424_17197 257
38 3300042612 Ga0466705_172961 Ga0466705_172961_1021_1794 257
39 3300042618 Ga0466723_023716 Ga0466723_023716_22684_23499 257
40 3300042618 Ga0466723_043166 Ga0466723_043166_681_1454 257
41 3300042636 Ga0466703_188982 Ga0466703_188982_56_829 257
42 3300042648 Ga0466709_258735 Ga0466709_258735_22367_23140 257
43 3300042593 Ga0466691_186489 Ga0466691_186489_1891_2706 258
44 3300042605 Ga0466716_311125 Ga0466716_311125_262_1038 258
45 3300042609 Ga0466722_124768 Ga0466722_124768_8128_8904 258
46 3300042615 Ga0466711_195788 Ga0466711_195788_37576_38352 258
47 3300042615 Ga0466711_391543 Ga0466711_391543_298_1074 258
48 3300042616 Ga0466715_136168 Ga0466715_136168_7771_8547 258
49 3300042619 Ga0466726_072398 Ga0466726_072398_563_1339 258
50 3300042605 Ga0466716_063828 Ga0466716_063828_5654_6469 259
51 3300042652 Ga0466708_463540 Ga0466708_463540_207_1022 259
52 3300042595 Ga0466695_280829 Ga0466695_280829_1268_2050 260
53 iso_pr_bacteria 2781125696 2781440570 260
54 3300002462 JGI24702J35022_10010554 JGI24702J35022_100105543 261
55 3300042590 Ga0466690_425403 Ga0466690_425403_143_928 261
56 3300042592 Ga0466693_358918 Ga0466693_358918_597_1382 261
57 3300042593 Ga0466691_067175 Ga0466691_067175_8124_8909 261
58 3300042593 Ga0466691_102941 Ga0466691_102941_1187_1972 261
59 3300042596 Ga0466696_266448 Ga0466696_266448_17793_18578 261
60 3300042605 Ga0466716_401828 Ga0466716_401828_1103_1888 261
61 3300042606 Ga0466719_052505 Ga0466719_052505_254_1039 261
62 3300042612 Ga0466705_179579 Ga0466705_179579_2102_2887 261
63 3300042615 Ga0466711_077314 Ga0466711_077314_764_1549 261
64 3300042616 Ga0466715_061446 Ga0466715_061446_407_1192 261
65 3300042616 Ga0466715_063064 Ga0466715_063064_27_812 261
66 3300042616 Ga0466715_349008 Ga0466715_349008_538_1323 261
67 3300042617 Ga0466718_123069 Ga0466718_123069_245_1030 261
68 3300042620 Ga0466728_417071 Ga0466728_417071_750_1535 261
69 3300042636 Ga0466703_109964 Ga0466703_109964_15012_15797 261
70 3300042643 Ga0466704_097597 Ga0466704_097597_586_1371 261
71 3300042648 Ga0466709_102081 Ga0466709_102081_745_1530 261
72 3300042648 Ga0466709_193050 Ga0466709_193050_1097_1882 261
73 3300042652 Ga0466708_021866 Ga0466708_021866_11924_12709 261
74 3300042656 Ga0466732_038600 Ga0466732_038600_1053_1838 261
75 3300042624 Ga0466735_014604 Ga0466735_014604_309_1154 262
76 iso_pr_bacteria 2781125694 2781435006 262
77 3300010049 Ga0123356_10000331 Ga0123356_100003316 263
78 3300010049 Ga0123356_10546428 Ga0123356_105464282 263
79 3300010049 Ga0123356_10718413 Ga0123356_107184132 263
80 3300010167 Ga0123353_10619721 Ga0123353_106197212 263
81 3300010167 Ga0123353_10910514 Ga0123353_109105142 263
82 3300042601 Ga0466707_015357 Ga0466707_015357_855_1646 263
83 3300042617 Ga0466718_091528 Ga0466718_091528_32_823 263
84 3300042620 Ga0466728_011064 Ga0466728_011064_1935_2750 263
85 3300042643 Ga0466704_227433 Ga0466704_227433_2085_2891 263
86 3300042643 Ga0466704_594897 Ga0466704_594897_4804_5595 263
87 3300042594 Ga0466694_354300 Ga0466694_354300_22_816 264
88 3300042599 Ga0466706_018505 Ga0466706_018505_177_971 264
89 3300002462 JGI24702J35022_10008569 JGI24702J35022_100085693 265
90 3300002462 JGI24702J35022_10098944 JGI24702J35022_100989442 265
91 3300010049 Ga0123356_10038918 Ga0123356_100389182 265
92 3300038395 Ga0415639_038845 Ga0415639_038845_478_1275 265
93 3300042595 Ga0466695_367109 Ga0466695_367109_681_1481 266
94 3300042602 Ga0466713_155128 Ga0466713_155128_2087_2887 266
95 3300042614 Ga0466712_005251 Ga0466712_005251_1352_2152 266
96 3300042615 Ga0466711_120404 Ga0466711_120404_4266_5081 266
97 3300042618 Ga0466723_050995 Ga0466723_050995_1640_2440 266
98 iso_pr_bacteria 2781125630 2781265488 266
99 3300042591 Ga0466692_028867 Ga0466692_028867_6224_7027 267
100 3300042609 Ga0466722_049863 Ga0466722_049863_775_1578 267
101 3300002449 JGI24698J34947_10002698 JGI24698J34947_1000269811 268
102 3300042596 Ga0466696_010817 Ga0466696_010817_2521_3327 268
103 3300002450 JGI24695J34938_10006985 JGI24695J34938_100069855 269
104 3300042593 Ga0466691_128820 Ga0466691_128820_422_1231 269
105 3300042655 Ga0466727_236378 Ga0466727_236378_1943_2752 269
106 3300042590 Ga0466690_009121 Ga0466690_009121_9669_10481 270
107 3300042605 Ga0466716_100842 Ga0466716_100842_828_1643 271
108 3300042610 Ga0466698_240409 Ga0466698_240409_249_1064 271
109 3300042615 Ga0466711_011926 Ga0466711_011926_736_1551 271
110 3300042616 Ga0466715_000382 Ga0466715_000382_1295_2110 271
111 3300042618 Ga0466723_029142 Ga0466723_029142_1296_2111 271
112 3300042636 Ga0466703_192023 Ga0466703_192023_830_1645 271
113 3300042636 Ga0466703_389486 Ga0466703_389486_2387_3202 271
114 3300042643 Ga0466704_028477 Ga0466704_028477_12731_13546 271
115 3300042593 Ga0466691_115443 Ga0466691_115443_2230_3048 272
116 3300042596 Ga0466696_189438 Ga0466696_189438_1974_2792 272
117 3300042599 Ga0466706_075389 Ga0466706_075389_8414_9295 273
118 3300042602 Ga0466713_139080 Ga0466713_139080_982_1803 273
119 3300010167 Ga0123353_10262731 Ga0123353_102627312 275
120 3300042602 Ga0466713_148635 Ga0466713_148635_291_1118 275
121 3300005083 Ga0068305_10003725 Ga0068305_100037253 276
122 3300002462 JGI24702J35022_10010186 JGI24702J35022_100101864 277
123 3300042609 Ga0466722_181203 Ga0466722_181203_29522_30355 277
124 3300042612 Ga0466705_111372 Ga0466705_111372_89_931 280
125 3300002462 JGI24702J35022_10053145 JGI24702J35022_100531452 281
126 3300042606 Ga0466719_498156 Ga0466719_498156_17253_18110 285
127 3300042619 Ga0466726_069480 Ga0466726_069480_9791_10660 289
128 3300010167 Ga0123353_10311267 Ga0123353_103112671 310

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.