Protein Family IF08194

Metagenome Isolate
123 Members
37 Samples
112 Scaffolds
391.93 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_033408|Ga0466726_033408_17690_19006
Length
428 aa
Sequence
MPRSLSGIIAPLGSNNSQVRQAPSLCTDLGYISLNKHGELLCGDHVEIAHSFQSEFSAAHKGRDAKGYKETGRRQTGKGDFTVVVLADGLGSGVKANILSTLTSLTVEDCVSTIAATLPVRSELGIAYSTFTIIKITRNQEAEIIQYDNPQVIFLRDGKTFDYQKTVETIDSKTIYKTHVALKEGDTFIALSDGAIHAGTGPELNLDWERDDIAAFMEGIYEPGYTAKTLSTMLINKCYSLYGGEPGDDTTVCTVKIRPRRPVNMLIGPPEDPKDLNKMMNLFFSKEGKHIISGGTTSHLAAEFLKQKLDASIPPSRSDPDIPPVSRIEGVDLVTEGVITLQRVAEYARDFTGNNENYTDWTGGDDGASLISQLLFEEATDINFFVGKAVNRDQKEDARISFVLKMKLIEELAAYLKTMGKQIKISYF

πŸ“Š Sample Types

Isolate 8.9%
Metagenome 91.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Kalotermitidae 40.5%
Blattidae 21.6%
Termitidae 13.5%
Unclassified 8.1%
Termopsidae 8.1%
Passalidae 5.4%
Hodotermitidae 2.7%

🌳 Taxonomy

Archaea 0
Bacteria 118
Eukaryota 0
Viruses 0
Unclassified 5

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 2940361758 Breznakia sp. PFB1-14 Isolate Blattidae
3 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
4 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 2940352027 Breznakia sp. PH1-1 Isolate Blattidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2940368928 Breznakia sp. PFB2-30 Isolate Blattidae
13 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
14 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
15 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
16 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
17 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
18 2940359323 Breznakia sp. PFB1-12 Isolate Blattidae
19 2940366561 Breznakia sp. PFB1-4 Isolate Blattidae
20 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
21 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
22 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
23 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
24 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
25 2940356891 Breznakia sp. PFB1-11 Isolate Blattidae
26 2940364193 Breznakia sp. PFB1-19 Isolate Blattidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
29 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
30 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
31 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
32 2788499854 Breznakia blatticola DSM 28867 Isolate Unclassified
33 2940354458 Breznakia sp. PF1-11 Isolate Blattidae
34 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
35 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
36 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466716_371632 3300042605 Bacteria 7543
2 Ga0466705_390525 3300042612 Bacteria 3793
3 Ga0466711_308603 3300042615 Bacteria 3184
4 Ga0466715_396821 3300042616 Unclassified 2031
5 Ga0466723_140474 3300042618 Bacteria 9033
6 Ga0466726_484870 3300042619 Bacteria 2923
7 Ga0123353_10313785 3300010167 Bacteria 2384
8 Ga0466735_190263 3300042624 Bacteria 22194
9 Ga0466704_420575 3300042643 Bacteria 1784
10 Ga0466708_275922 3300042652 Bacteria 5053
11 Ga0466706_156107 3300042599 Bacteria 1852
12 Ga0466719_082600 3300042606 Bacteria 5231
13 Ga0466719_262828 3300042606 Bacteria 13871
14 Ga0466711_041437 3300042615 Bacteria 4157
15 Ga0466715_039077 3300042616 Bacteria 5184
16 Ga0466715_322578 3300042616 Bacteria 4948
17 Ga0466723_268880 3300042618 Bacteria 2680
18 Ga0466723_351800 3300042618 Bacteria 6533
19 Ga0466726_033408 3300042619 Bacteria 25334
20 Ga0466728_064931 3300042620 Bacteria 2231
21 Ga0466728_224101 3300042620 Bacteria 13702
22 Ga0466704_030169 3300042643 Bacteria 20996
23 Ga0466704_419113 3300042643 Bacteria 1635
24 Ga0466709_081804 3300042648 Bacteria 9884
25 Ga0466708_314940 3300042652 Bacteria 5813
26 Ga0466727_156177 3300042655 Bacteria 1206
27 Ga0466727_273283 3300042655 Bacteria 5813
28 Ga0466705_200686 3300042612 Bacteria 20073
29 Ga0466707_162858 3300042601 Bacteria 1613
30 Ga0466716_167369 3300042605 Bacteria 7943
31 Ga0466696_099562 3300042596 Bacteria 16549
32 Ga0466711_060498 3300042615 Bacteria 2422
33 Ga0466711_111545 3300042615 Bacteria 27671
34 Ga0466711_354091 3300042615 Bacteria 27845
35 Ga0466715_313298 3300042616 Bacteria 5880
36 Ga0466728_088479 3300042620 Bacteria 8136
37 Ga0466728_249234 3300042620 Unclassified 1421
38 Ga0123355_10293442 3300009826 Bacteria 2227
39 IMNBL1DRAFT_c0020464 3300000062 Bacteria 2679
40 Ga0466703_132976 3300042636 Bacteria 4891
41 Ga0466703_150343 3300042636 Bacteria 12421
42 Ga0466709_060098 3300042648 Bacteria 6780
43 Ga0466709_262241 3300042648 Bacteria 11525
44 Ga0466719_208318 3300042606 Bacteria 12805
45 Ga0466690_040289 3300042590 Bacteria 3000
46 Ga0466691_170431 3300042593 Bacteria 3247
47 Ga0466691_204215 3300042593 Bacteria 1483
48 Ga0466711_012945 3300042615 Bacteria 9710
49 Ga0466711_282119 3300042615 Bacteria 18149
50 Ga0466711_379432 3300042615 Bacteria 5389
51 Ga0466715_020133 3300042616 Bacteria 6712
52 Ga0466715_169504 3300042616 Bacteria 15427
53 Ga0466715_254922 3300042616 Bacteria 30280
54 Ga0466726_031495 3300042619 Bacteria 3403
55 Ga0466726_318114 3300042619 Bacteria 2285
56 2227505178 2225789004 Bacteria 18909
57 IMNBL1DRAFT_c0002968 3300000062 Bacteria 11270
58 JGI24698J34947_10012311 3300002449 Bacteria 4688
59 Ga0466708_035489 3300042652 Bacteria 1725
60 Ga0466727_320086 3300042655 Bacteria 1724
61 Ga0466705_270667 3300042612 Bacteria 7848
62 Ga0466706_063380 3300042599 Bacteria 2851
63 Ga0466719_238848 3300042606 Bacteria 13045
64 Ga0466691_088619 3300042593 Bacteria 11850
65 Ga0466696_140542 3300042596 Bacteria 7721
66 Ga0466705_532403 3300042612 Bacteria 3601
67 Ga0466712_128729 3300042614 Bacteria 5378
68 Ga0466711_069070 3300042615 Bacteria 40971
69 Ga0466715_238842 3300042616 Bacteria 12073
70 Ga0466704_213933 3300042643 Bacteria 7081
71 Ga0466727_139480 3300042655 Bacteria 2172
72 Ga0466690_370698 3300042590 Bacteria 7814
73 Ga0466696_062598 3300042596 Unclassified 2815
74 Ga0466696_316620 3300042596 Bacteria 5904
75 Ga0466711_022403 3300042615 Bacteria 5346
76 Ga0466711_203816 3300042615 Bacteria 19603
77 Ga0466715_042385 3300042616 Bacteria 4316
78 Ga0466715_136590 3300042616 Bacteria 2158
79 Ga0466726_307248 3300042619 Bacteria 3397
80 Ga0466735_182537 3300042624 Bacteria 1825
81 Ga0466703_157929 3300042636 Bacteria 4509
82 Ga0466704_045285 3300042643 Bacteria 7216
83 Ga0466704_100115 3300042643 Unclassified 9274
84 Ga0466709_248936 3300042648 Bacteria 3491
85 Ga0466708_013512 3300042652 Bacteria 4668
86 Ga0466708_146539 3300042652 Bacteria 13642
87 Ga0466705_195029 3300042612 Bacteria 6975
88 Ga0466705_320717 3300042612 Bacteria 4449
89 Ga0466716_126216 3300042605 Bacteria 1470
90 Ga0466690_173713 3300042590 Bacteria 1628
91 Ga0466691_021261 3300042593 Bacteria 9129
92 Ga0466691_036001 3300042593 Bacteria 2149
93 Ga0466696_021085 3300042596 Bacteria 4564
94 Ga0466711_152193 3300042615 Bacteria 3309
95 Ga0466726_451745 3300042619 Bacteria 1870
96 Ga0466735_085688 3300042624 Bacteria 11557
97 Ga0466735_132706 3300042624 Bacteria 24130
98 Ga0466703_053358 3300042636 Bacteria 24726
99 Ga0466709_082982 3300042648 Unclassified 1502
100 Ga0466709_275708 3300042648 Bacteria 7970
101 Ga0466727_205228 3300042655 Bacteria 1849
102 Ga0466716_051234 3300042605 Bacteria 6329
103 Ga0466719_158388 3300042606 Bacteria 4066
104 Ga0466690_268837 3300042590 Bacteria 3488
105 Ga0466690_366287 3300042590 Bacteria 8455
106 Ga0466723_159545 3300042618 Bacteria 1992
107 Ga0466726_057920 3300042619 Bacteria 2367
108 Ga0466726_102150 3300042619 Bacteria 4149
109 Ga0466709_237082 3300042648 Bacteria 2698
110 Ga0466724_54796 3300042649 Bacteria 2909
111 Ga0466708_138559 3300042652 Bacteria 1454
112 Ga0466708_211043 3300042652 Bacteria 7680

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042652 Ga0466708_138559 Ga0466708_138559_336_1436 351
2 3300042616 Ga0466715_042385 Ga0466715_042385_2270_3442 354
3 3300042619 Ga0466726_307248 Ga0466726_307248_656_1798 371
4 3300042655 Ga0466727_156177 Ga0466727_156177_52_1188 371
5 3300042601 Ga0466707_162858 Ga0466707_162858_221_1393 372
6 3300042616 Ga0466715_238842 Ga0466715_238842_4814_5989 372
7 3300042616 Ga0466715_396821 Ga0466715_396821_254_1459 373
8 3300042619 Ga0466726_484870 Ga0466726_484870_141_1313 376
9 3300042593 Ga0466691_204215 Ga0466691_204215_204_1376 377
10 3300042615 Ga0466711_282119 Ga0466711_282119_4318_5490 377
11 3300042612 Ga0466705_200686 Ga0466705_200686_4510_5685 378
12 3300042624 Ga0466735_132706 Ga0466735_132706_17816_18994 378
13 3300042606 Ga0466719_208318 Ga0466719_208318_4608_5783 379
14 3300042615 Ga0466711_012945 Ga0466711_012945_5267_6442 379
15 3300042643 Ga0466704_420575 Ga0466704_420575_212_1384 379
16 3300042652 Ga0466708_146539 Ga0466708_146539_7321_8496 379
17 3300042655 Ga0466727_139480 Ga0466727_139480_345_1517 379
18 3300042643 Ga0466704_030169 Ga0466704_030169_7129_8307 380
19 3300042612 Ga0466705_532403 Ga0466705_532403_2137_3318 381
20 3300042615 Ga0466711_069070 Ga0466711_069070_9044_10216 381
21 3300042618 Ga0466723_140474 Ga0466723_140474_5498_6706 381
22 3300042652 Ga0466708_035489 Ga0466708_035489_121_1311 381
23 3300042605 Ga0466716_167369 Ga0466716_167369_1771_2958 382
24 3300042615 Ga0466711_022403 Ga0466711_022403_1641_2816 382
25 3300042620 Ga0466728_088479 Ga0466728_088479_2099_3274 382
26 3300042620 Ga0466728_224101 Ga0466728_224101_7650_8834 382
27 3300042616 Ga0466715_322578 Ga0466715_322578_1234_2409 383
28 iso_pr_bacteria 651324002 651581381 383
29 2225789004 2227505178 2227992071 384
30 3300000062 IMNBL1DRAFT_c0002968 IMNBL1DRAFT_00029682 384
31 3300042616 Ga0466715_169504 Ga0466715_169504_2168_3358 384
32 3300042648 Ga0466709_237082 Ga0466709_237082_1270_2460 384
33 3300042648 Ga0466709_262241 Ga0466709_262241_9392_10582 384
34 3300042652 Ga0466708_013512 Ga0466708_013512_1895_3085 384
35 3300000062 IMNBL1DRAFT_c0020464 IMNBL1DRAFT_00204643 385
36 3300042648 Ga0466709_060098 Ga0466709_060098_2267_3454 385
37 3300002449 JGI24698J34947_10012311 JGI24698J34947_100123111 386
38 3300042590 Ga0466690_173713 Ga0466690_173713_351_1538 386
39 3300042612 Ga0466705_320717 Ga0466705_320717_2523_3713 387
40 3300042616 Ga0466715_254922 Ga0466715_254922_11656_12846 387
41 3300042652 Ga0466708_275922 Ga0466708_275922_2079_3287 387
42 3300042615 Ga0466711_041437 Ga0466711_041437_800_1993 388
43 3300042618 Ga0466723_351800 Ga0466723_351800_1821_3029 388
44 3300042643 Ga0466704_100115 Ga0466704_100115_2871_4094 388
45 3300042599 Ga0466706_063380 Ga0466706_063380_1139_2368 389
46 3300042615 Ga0466711_060498 Ga0466711_060498_227_1441 389
47 3300042615 Ga0466711_308603 Ga0466711_308603_1371_2540 389
48 3300042615 Ga0466711_354091 Ga0466711_354091_2151_3365 389
49 3300042605 Ga0466716_051234 Ga0466716_051234_3199_4407 390
50 3300042606 Ga0466719_262828 Ga0466719_262828_10701_11906 390
51 3300042624 Ga0466735_085688 Ga0466735_085688_2554_3726 390
52 3300042643 Ga0466704_045285 Ga0466704_045285_465_1670 390
53 3300042643 Ga0466704_419113 Ga0466704_419113_212_1384 390
54 3300042655 Ga0466727_205228 Ga0466727_205228_43_1242 390
55 3300042590 Ga0466690_366287 Ga0466690_366287_4802_6010 391
56 3300042599 Ga0466706_156107 Ga0466706_156107_560_1735 391
57 3300042612 Ga0466705_390525 Ga0466705_390525_51_1226 391
58 3300042614 Ga0466712_128729 Ga0466712_128729_1976_3151 391
59 3300042615 Ga0466711_379432 Ga0466711_379432_2217_3392 391
60 3300042648 Ga0466709_082982 Ga0466709_082982_51_1259 391
61 3300009826 Ga0123355_10293442 Ga0123355_102934422 392
62 3300010167 Ga0123353_10313785 Ga0123353_103137852 392
63 3300042619 Ga0466726_031495 Ga0466726_031495_288_1496 392
64 3300042636 Ga0466703_150343 Ga0466703_150343_5016_6221 392
65 iso_pr_bacteria 2788499854 2788758569 392
66 iso_pr_bacteria 2940352027 2940353556 392
67 iso_pr_bacteria 2940354458 2940356030 392
68 iso_pr_bacteria 2940356891 2940358464 392
69 iso_pr_bacteria 2940359323 2940360942 392
70 iso_pr_bacteria 2940361758 2940363288 392
71 iso_pr_bacteria 2940364193 2940365742 392
72 iso_pr_bacteria 2940366561 2940368065 392
73 iso_pr_bacteria 2940368928 2940370278 392
74 3300042648 Ga0466709_275708 Ga0466709_275708_2064_3272 393
75 3300042619 Ga0466726_451745 Ga0466726_451745_128_1342 394
76 3300042624 Ga0466735_182537 Ga0466735_182537_35_1267 394
77 3300042596 Ga0466696_099562 Ga0466696_099562_13313_14536 395
78 3300042612 Ga0466705_195029 Ga0466705_195029_5041_6264 395
79 3300042619 Ga0466726_318114 Ga0466726_318114_41_1255 395
80 3300042593 Ga0466691_088619 Ga0466691_088619_6121_7311 396
81 3300042606 Ga0466719_238848 Ga0466719_238848_7035_8225 396
82 3300042652 Ga0466708_211043 Ga0466708_211043_3856_5085 396
83 3300042615 Ga0466711_152193 Ga0466711_152193_605_1825 397
84 3300042616 Ga0466715_020133 Ga0466715_020133_674_1897 397
85 3300042624 Ga0466735_190263 Ga0466735_190263_2612_3826 397
86 3300042590 Ga0466690_370698 Ga0466690_370698_514_1737 398
87 3300042615 Ga0466711_111545 Ga0466711_111545_8040_9251 398
88 3300042596 Ga0466696_062598 Ga0466696_062598_1496_2722 399
89 3300042649 Ga0466724_54796 Ga0466724_54796_1000_2202 400
90 3300042643 Ga0466704_213933 Ga0466704_213933_4820_6025 401
91 3300042596 Ga0466696_140542 Ga0466696_140542_4844_6052 402
92 3300042596 Ga0466696_316620 Ga0466696_316620_1593_2801 402
93 3300042605 Ga0466716_371632 Ga0466716_371632_3628_4836 402
94 3300042606 Ga0466719_082600 Ga0466719_082600_3195_4403 402
95 3300042615 Ga0466711_203816 Ga0466711_203816_11675_12910 402
96 3300042616 Ga0466715_039077 Ga0466715_039077_2147_3355 402
97 3300042636 Ga0466703_132976 Ga0466703_132976_3413_4621 402
98 3300042648 Ga0466709_081804 Ga0466709_081804_3998_5239 402
99 3300042655 Ga0466727_273283 Ga0466727_273283_1555_2790 402
100 3300042619 Ga0466726_057920 Ga0466726_057920_155_1396 403
101 3300042620 Ga0466728_064931 Ga0466728_064931_528_1739 403
102 3300042620 Ga0466728_249234 Ga0466728_249234_145_1356 403
103 3300042648 Ga0466709_248936 Ga0466709_248936_1345_2556 403
104 3300042655 Ga0466727_320086 Ga0466727_320086_207_1418 403
105 3300042612 Ga0466705_270667 Ga0466705_270667_4358_5572 404
106 3300042619 Ga0466726_102150 Ga0466726_102150_1744_2991 405
107 3300042590 Ga0466690_040289 Ga0466690_040289_75_1298 407
108 3300042590 Ga0466690_268837 Ga0466690_268837_75_1298 407
109 3300042593 Ga0466691_021261 Ga0466691_021261_3114_4337 407
110 3300042593 Ga0466691_036001 Ga0466691_036001_498_1721 407
111 3300042596 Ga0466696_021085 Ga0466696_021085_1102_2325 407
112 3300042605 Ga0466716_126216 Ga0466716_126216_163_1386 407
113 3300042636 Ga0466703_053358 Ga0466703_053358_7180_8403 407
114 3300042606 Ga0466719_158388 Ga0466719_158388_2420_3646 408
115 3300042616 Ga0466715_136590 Ga0466715_136590_78_1304 408
116 3300042616 Ga0466715_313298 Ga0466715_313298_49_1275 408
117 3300042636 Ga0466703_157929 Ga0466703_157929_41_1267 408
118 3300042652 Ga0466708_314940 Ga0466708_314940_3260_4486 408
119 3300042593 Ga0466691_170431 Ga0466691_170431_864_2099 411
120 3300042618 Ga0466723_268880 Ga0466723_268880_532_1773 413
121 3300042618 Ga0466723_159545 Ga0466723_159545_32_1276 414
122 iso_pr_bacteria 650716099 650877544 417
123 3300042619 Ga0466726_033408 Ga0466726_033408_17690_19006 428

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07228 SpoIIE Stage II sporulation protein E (SpoIIE) 82 257 0.76

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.