Protein Family IF08186

Metagenome Isolate
172 Members
98 Samples
140 Scaffolds
398.36 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_005761|Ga0466726_005761_317_1705
Length
462 aa
Sequence
LKVTLQFFHKPQVIVNVTMFPPKMKGDAVKNFAVCTLVPPTVLYISWYYCKAIKFDLSATKVRKIIMSIGVSKIIQGLEPSATLAMSAKAKELKAQGKTVYDLSVGEPDFVTPQHICDAGTVAMKAGHTKYTIASGIPELKKAIAEKYKADYGLEYAPSQIVISNGAKHSLHNAFFTTLDPGDEVIIPAPYWVSYAELVKLSGAVPVIVPTEESQNFKMPVAQFEKAITPKTKMLLLCSPSNPTGAMYSGDELRAIADIVLQKSLFVVADEIYDKLVYGSNKFVSFPTLRSGLQDRTIVVNGASKTYAMTGWRVGWTFSPENVAKKMGELQSQETSNPCSISQYAALAALTGSQDCVAKMLTAFTERRDYVAKRIAGIDGLSCPEMSGAFYAFFNIKKHLGRKLDGVLIHNSEQFCLELLTQKQVATVMGSSFGCEGYVRASFAAGIDILKTAFDRIAEFVS

📊 Sample Types

Isolate 18.6%
Metagenome 81.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 21.3%
Drosophilidae 20.2%
Kalotermitidae 14.6%
Unclassified 10.1%
Armadillidiidae 10.1%
Culicidae 6.7%
Formicidae 4.5%
Rhinotermitidae 3.4%
Termopsidae 3.4%
Passalidae 1.1%
Bombycidae 1.1%
Muscidae 1.1%
Daphniidae 1.1%
Hydrophilidae 1.1%

🌳 Taxonomy

Archaea 1
Bacteria 158
Eukaryota 4
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2597490292 Acetobacter malorum DmCS_005 Isolate Drosophilidae
2 2820185449 Unclassified Planctomycetes Lab288P3bin146 Isolate Unclassified
3 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
4 2896321640 Sphingobacterium sp. xlx-130 Isolate
5 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
6 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
7 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
8 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
9 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
12 2820178484 Unclassified Planctomycetes Th196P3bin110 Isolate Unclassified
13 2854536247 Acetobacter senegalensis DmL_050 Isolate Drosophilidae
14 2858102877 Acetobacter orientalis DmW_048 Isolate Drosophilidae
15 2858129007 Acetobacter orientalis DmW_045 Isolate Drosophilidae
16 2896330536 Sphingobacterium sp. xlx-96 Isolate
17 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
18 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
19 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
20 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
21 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
22 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
23 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
24 2854518031 Acetobacter indonesiensis DmW_046 Isolate Drosophilidae
25 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
26 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
27 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
28 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
29 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
30 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
31 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
32 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
33 2858089842 Acetobacter tropicalis DmW_042 Isolate Drosophilidae
34 2858110640 Acetobacter indonesiensis DmL_051 Isolate Drosophilidae
35 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
36 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
37 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
38 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
39 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
40 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
41 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
42 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
43 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
44 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
45 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
46 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
47 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
48 2816332478 Acetobacter tropicalis BDGP1 Isolate Drosophilidae
49 2868677537 Acetobacter orientalis DsW_061 Isolate Drosophilidae
50 2898741527 Sphingobacterium sp. xlx-73 Isolate
51 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
52 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
53 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
54 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
55 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
56 651324000 Acetobacter pomorum DM001 Isolate Drosophilidae
57 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
58 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
59 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
60 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
61 2834852038 Acetobacter cibinongensis DsW_47 Isolate Drosophilidae
62 2858105562 Acetobacter sp. DsW_059 Isolate Drosophilidae
63 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
64 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
65 8067483258 Ochrobactrum soli MTP-C0764 Isolate Muscidae
66 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
67 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
68 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
69 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
70 2820611732 Unclassified Firmicutes Emb289P1bin19 Isolate Unclassified
71 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
72 2854548700 Acetobacter persici DmL_053 Isolate Drosophilidae
73 2868683769 Acetobacter sp. DmW_043 Isolate Drosophilidae
74 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
75 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
76 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
77 2987037630 Oecophyllibacter saccharovorans Ha5 Isolate Formicidae
78 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
79 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
80 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
81 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
82 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
83 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
84 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
85 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
86 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
87 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
88 2820196379 Unclassified Planctomycetes Emb289P3bin158 Isolate Unclassified
89 2858119979 Acetobacter malorum DsW_057 Isolate Drosophilidae
90 2896350215 Sphingobacterium sp. xlx-183 Isolate
91 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
92 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
93 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
94 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
95 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
96 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
97 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
98 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466701_102988 3300042598 Bacteria 1383
2 Ga0466707_383225 3300042601 Bacteria 31315
3 Ga0466716_152536 3300042605 Bacteria 3595
4 Ga0466719_517355 3300042606 Bacteria 6718
5 IMNBGM34_c001111 3300000036 Bacteria 5238
6 JGI24695J34938_10017618 3300002450 Bacteria 3591
7 JGI24695J34938_10058052 3300002450 Bacteria 1661
8 Ga0102740_1003330 3300007140 Bacteria 4769
9 Ga0466723_371180 3300042618 Bacteria 15144
10 Ga0160467_100463 3300012829 Unclassified 39684
11 Ga0160455_100185 3300012837 Bacteria 59944
12 Ga0160445_100417 3300012847 Bacteria 23081
13 Ga0160445_101315 3300012847 Bacteria 7349
14 Ga0466691_008788 3300042593 Eukaryota 1976
15 Ga0466696_010052 3300042596 Bacteria 2385
16 Ga0466729_293961 3300042621 Bacteria 2509
17 Ga0466703_409267 3300042636 Bacteria 4649
18 Ga0466704_165666 3300042643 Bacteria 1850
19 Ga0466708_214923 3300042652 Bacteria 13794
20 Ga0123355_10020085 3300009826 Bacteria 10654
21 Ga0123353_10002117 3300010167 Bacteria 24550
22 Ga0123353_10311943 3300010167 Bacteria 2393
23 Ga0466707_190491 3300042601 Bacteria 20271
24 Ga0466714_136997 3300042603 Bacteria 5234
25 Ga0102734_1000951 3300007129 Bacteria 9556
26 Ga0466715_176814 3300042616 Bacteria 11551
27 Ga0466715_646891 3300042616 Bacteria 4531
28 Ga0466723_158384 3300042618 Bacteria 7873
29 Ga0466726_005761 3300042619 Bacteria 2837
30 Ga0466726_345058 3300042619 Bacteria 18048
31 Ga0160433_101315 3300012846 Bacteria 7182
32 Ga0415639_051974 3300038395 Eukaryota 2263
33 Ga0466690_160122 3300042590 Bacteria 11975
34 Ga0466693_237959 3300042592 Unclassified 1233
35 Ga0466699_347869 3300042597 Bacteria 1716
36 Ga0466734_108586 3300042623 Bacteria 1918
37 Ga0466735_113613 3300042624 Bacteria 55484
38 Ga0466735_159098 3300042624 Bacteria 5774
39 Ga0123355_10083908 3300009826 Bacteria 5076
40 Ga0123356_10020650 3300010049 Bacteria 6228
41 Ga0123353_10000384 3300010167 Bacteria 54208
42 Ga0160442_100027 3300012806 Bacteria 268121
43 Ga0466700_447152 3300042600 Bacteria 5324
44 Ga0466716_037822 3300042605 Bacteria 19513
45 CVPL010W_10001989 3300002931 Unclassified 24269
46 Ga0104050_1003777 3300007153 Bacteria 5751
47 Ga0466711_271191 3300042615 Bacteria 5509
48 Ga0466723_288655 3300042618 Bacteria 14153
49 Ga0466729_127070 3300042621 Bacteria 4010
50 Ga0160453_101044 3300012814 Bacteria 12246
51 Ga0160446_100015 3300012835 Bacteria 268940
52 Ga0160435_1000046 3300012857 Unclassified 90992
53 Ga0466690_064769 3300042590 Bacteria 12578
54 Ga0466690_097416 3300042590 Bacteria 1869
55 Ga0466701_000344 3300042598 Unclassified 3624
56 Ga0123355_10001261 3300009826 Bacteria 35356
57 Ga0123356_10071380 3300010049 Bacteria 3259
58 Ga0123353_10018735 3300010167 Bacteria 10251
59 Ga0123353_10440448 3300010167 Bacteria 1923
60 Ga0072941_1159105 3300005201 Bacteria 8393
61 Ga0072941_1180113 3300005201 Bacteria 3049
62 Ga0466729_018888 3300042621 Bacteria 13239
63 Ga0160453_100001 3300012814 Bacteria 1272344
64 Ga0160459_100023 3300012831 Bacteria 364187
65 Ga0160443_100148 3300012848 Bacteria 101089
66 Ga0160457_1001994 3300012858 Bacteria 4807
67 Ga0466691_190578 3300042593 Bacteria 5530
68 Ga0123353_10041105 3300010167 Bacteria 7300
69 Ga0466733_135775 3300042659 Bacteria 1712
70 Ga0466700_137560 3300042600 Bacteria 2483
71 JGI24695J34938_10036190 3300002450 Bacteria 2252
72 Ga0466718_038393 3300042617 Bacteria 1497
73 Ga0466723_130028 3300042618 Bacteria 7793
74 Ga0160440_101969 3300012815 Unclassified 2315
75 Ga0160468_100099 3300012819 Unclassified 100492
76 Ga0160469_101026 3300012824 Bacteria 8851
77 Ga0160472_100651 3300012839 Bacteria 17700
78 Ga0160444_100042 3300012841 Bacteria 196567
79 Ga0160433_100052 3300012846 Bacteria 131130
80 Ga0466696_139793 3300042596 Bacteria 44856
81 Ga0466703_097090 3300042636 Bacteria 8249
82 Ga0466703_327547 3300042636 Bacteria 29461
83 Ga0466703_422565 3300042636 Bacteria 1990
84 Ga0466724_34893 3300042649 Bacteria 121190
85 Ga0123353_10000411 3300010167 Bacteria 52882
86 Ga0123353_10204759 3300010167 Bacteria 3101
87 Ga0466722_019761 3300042609 Bacteria 8416
88 IMNBGM34_c002217 3300000036 Bacteria 2915
89 Ga0102740_1000111 3300007140 Bacteria 20936
90 Ga0466711_020516 3300042615 Bacteria 6199
91 Ga0466723_110837 3300042618 Bacteria 15054
92 Ga0466726_395472 3300042619 Bacteria 1800
93 Ga0160453_100400 3300012814 Bacteria 36021
94 Ga0160434_100055 3300012850 Bacteria 84316
95 Ga0160457_1000001 3300012858 Bacteria 1192173
96 Ga0466693_118243 3300042592 Bacteria 2980
97 Ga0466731_135492 3300042622 Bacteria 3242
98 Ga0466703_341757 3300042636 Bacteria 3131
99 Ga0466704_026916 3300042643 Bacteria 143520
100 Ga0466709_073055 3300042648 Bacteria 1717
101 Ga0466727_244961 3300042655 Bacteria 6303
102 Ga0123356_10218487 3300010049 Archaea 1960
103 Ga0123353_10005109 3300010167 Bacteria 17134
104 Ga0123353_10007931 3300010167 Bacteria 14437
105 Ga0466705_179912 3300042612 Unclassified 3032
106 Ga0466705_257271 3300042612 Bacteria 7795
107 Ga0466717_140069 3300042604 Bacteria 3314
108 Ga0466719_467372 3300042606 Bacteria 1825
109 Ga0104041_1032693 3300007106 Bacteria 3222
110 Ga0104048_1003111 3300007143 Bacteria 7741
111 Ga0160458_100140 3300012832 Bacteria 66872
112 Ga0160472_100061 3300012839 Bacteria 179642
113 Ga0160430_104253 3300012852 Bacteria 3618
114 Ga0456237_0008359 3300041968 Eukaryota 1566
115 Ga0466693_048550 3300042592 Bacteria 2980
116 Ga0466695_399584 3300042595 Bacteria 1972
117 Ga0466696_189835 3300042596 Bacteria 10520
118 Ga0466709_252598 3300042648 Bacteria 13977
119 Ga0466724_51309 3300042649 Bacteria 6702
120 Ga0466708_211985 3300042652 Bacteria 9147
121 Ga0466727_214843 3300042655 Bacteria 2557
122 Ga0123356_10198937 3300010049 Bacteria 2042
123 Ga0123353_10006457 3300010167 Bacteria 15608
124 Ga0466701_074000 3300042598 Bacteria 2183
125 Ga0466716_342359 3300042605 Bacteria 4684
126 JGI24702J35022_10037433 3300002462 Bacteria 2591
127 Ga0104048_1022249 3300007143 Bacteria 5721
128 Ga0466711_143912 3300042615 Bacteria 2544
129 Ga0160468_100143 3300012819 Bacteria 66884
130 Ga0160472_100010 3300012839 Bacteria 466892
131 Ga0415639_246503 3300038395 Eukaryota 1732
132 Ga0466694_096380 3300042594 Bacteria 1665
133 Ga0466699_035867 3300042597 Bacteria 1969
134 Ga0466729_251879 3300042621 Bacteria 3793
135 Ga0466734_030427 3300042623 Bacteria 4637
136 Ga0466703_064559 3300042636 Bacteria 1578
137 Ga0466724_08873 3300042649 Unclassified 5233
138 Ga0466708_163601 3300042652 Bacteria 33774
139 Ga0123356_10025456 3300010049 Bacteria 5562
140 Ga0123353_10711961 3300010167 Bacteria 1406

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2820765201 2820766819 356
2 3300042592 Ga0466693_118243 Ga0466693_118243_1859_2965 368
3 3300042592 Ga0466693_237959 Ga0466693_237959_14_1126 370
4 3300042618 Ga0466723_288655 Ga0466723_288655_3571_4764 371
5 3300042597 Ga0466699_035867 Ga0466699_035867_723_1862 379
6 3300042612 Ga0466705_179912 Ga0466705_179912_1444_2583 379
7 3300010049 Ga0123356_10218487 Ga0123356_102184872 380
8 3300012815 Ga0160440_101969 Ga0160440_1019693 380
9 3300042598 Ga0466701_000344 Ga0466701_000344_40_1182 380
10 3300042598 Ga0466701_102988 Ga0466701_102988_40_1182 380
11 3300042649 Ga0466724_08873 Ga0466724_08873_1521_2663 380
12 3300042649 Ga0466724_34893 Ga0466724_34893_120028_121170 380
13 3300012806 Ga0160442_100027 Ga0160442_100027234 381
14 3300012829 Ga0160467_100463 Ga0160467_10046326 381
15 3300012831 Ga0160459_100023 Ga0160459_100023118 381
16 3300012850 Ga0160434_100055 Ga0160434_10005543 381
17 3300010167 Ga0123353_10007931 Ga0123353_100079312 382
18 3300042616 Ga0466715_176814 Ga0466715_176814_3824_5026 382
19 3300010167 Ga0123353_10711961 Ga0123353_107119611 384
20 3300042636 Ga0466703_327547 Ga0466703_327547_6024_7226 387
21 3300042593 Ga0466691_008788 Ga0466691_008788_168_1361 390
22 3300042623 Ga0466734_108586 Ga0466734_108586_476_1648 390
23 3300042623 Ga0466734_030427 Ga0466734_030427_905_2131 391
24 iso_pr_bacteria 2820178484 2820180237 392
25 3300042621 Ga0466729_251879 Ga0466729_251879_541_1767 395
26 3300042601 Ga0466707_383225 Ga0466707_383225_428_1618 396
27 3300042636 Ga0466703_409267 Ga0466703_409267_846_2036 396
28 iso_pr_bacteria 2834951433 2834952409 396
29 3300000036 IMNBGM34_c002217 IMNBGM34_0022172 397
30 3300002462 JGI24702J35022_10037433 JGI24702J35022_100374331 397
31 3300010049 Ga0123356_10020650 Ga0123356_100206505 397
32 3300010049 Ga0123356_10198937 Ga0123356_101989372 397
33 3300012839 Ga0160472_100010 Ga0160472_100010278 397
34 3300012848 Ga0160443_100148 Ga0160443_1001488 397
35 3300038395 Ga0415639_051974 Ga0415639_051974_27_1220 397
36 3300041968 Ga0456237_0008359 Ga0456237_0008359_20_1213 397
37 3300042590 Ga0466690_097416 Ga0466690_097416_304_1497 397
38 3300042592 Ga0466693_048550 Ga0466693_048550_871_2064 397
39 3300042594 Ga0466694_096380 Ga0466694_096380_179_1372 397
40 3300042595 Ga0466695_399584 Ga0466695_399584_230_1423 397
41 3300042600 Ga0466700_137560 Ga0466700_137560_890_2083 397
42 3300042615 Ga0466711_143912 Ga0466711_143912_976_2169 397
43 3300042617 Ga0466718_038393 Ga0466718_038393_225_1418 397
44 3300042619 Ga0466726_345058 Ga0466726_345058_4150_5343 397
45 3300042621 Ga0466729_127070 Ga0466729_127070_909_2102 397
46 3300042636 Ga0466703_341757 Ga0466703_341757_940_2133 397
47 3300042648 Ga0466709_252598 Ga0466709_252598_11722_12915 397
48 3300042655 Ga0466727_244961 Ga0466727_244961_4416_5609 397
49 iso_pr_bacteria 2820185449 2820186145 397
50 3300000036 IMNBGM34_c001111 IMNBGM34_0011114 398
51 3300002450 JGI24695J34938_10036190 JGI24695J34938_100361902 398
52 3300005201 Ga0072941_1180113 Ga0072941_11801133 398
53 3300007140 Ga0102740_1000111 Ga0102740_10001112 398
54 3300010167 Ga0123353_10000384 Ga0123353_1000038427 398
55 3300010167 Ga0123353_10000411 Ga0123353_100004119 398
56 3300010167 Ga0123353_10002117 Ga0123353_100021179 398
57 3300010167 Ga0123353_10006457 Ga0123353_100064574 398
58 3300010167 Ga0123353_10311943 Ga0123353_103119433 398
59 3300012814 Ga0160453_101044 Ga0160453_1010447 398
60 3300012852 Ga0160430_104253 Ga0160430_1042532 398
61 3300042590 Ga0466690_064769 Ga0466690_064769_3980_5176 398
62 3300042590 Ga0466690_160122 Ga0466690_160122_7769_8965 398
63 3300042593 Ga0466691_190578 Ga0466691_190578_2176_3372 398
64 3300042596 Ga0466696_010052 Ga0466696_010052_446_1642 398
65 3300042596 Ga0466696_189835 Ga0466696_189835_4322_5518 398
66 3300042604 Ga0466717_140069 Ga0466717_140069_870_2066 398
67 3300042606 Ga0466719_467372 Ga0466719_467372_235_1431 398
68 3300042606 Ga0466719_517355 Ga0466719_517355_3134_4330 398
69 3300042609 Ga0466722_019761 Ga0466722_019761_3010_4206 398
70 3300042615 Ga0466711_020516 Ga0466711_020516_505_1701 398
71 3300042618 Ga0466723_110837 Ga0466723_110837_821_2017 398
72 3300042618 Ga0466723_158384 Ga0466723_158384_823_2019 398
73 3300042621 Ga0466729_293961 Ga0466729_293961_235_1431 398
74 3300042636 Ga0466703_422565 Ga0466703_422565_204_1400 398
75 3300042643 Ga0466704_026916 Ga0466704_026916_71073_72269 398
76 3300042652 Ga0466708_214923 Ga0466708_214923_11854_13050 398
77 3300042659 Ga0466733_135775 Ga0466733_135775_151_1347 398
78 iso_pr_bacteria 2590828803 2592927797 398
79 iso_pr_bacteria 2820171952 2820173113 398
80 iso_pr_bacteria 2873776654 2873781401 398
81 3300005201 Ga0072941_1159105 Ga0072941_11591053 399
82 3300010167 Ga0123353_10041105 Ga0123353_100411053 399
83 3300010167 Ga0123353_10204759 Ga0123353_102047592 399
84 3300010167 Ga0123353_10440448 Ga0123353_104404481 399
85 3300012814 Ga0160453_100400 Ga0160453_10040016 399
86 3300012819 Ga0160468_100099 Ga0160468_10009947 399
87 3300012835 Ga0160446_100015 Ga0160446_10001566 399
88 3300012839 Ga0160472_100061 Ga0160472_10006192 399
89 3300012839 Ga0160472_100651 Ga0160472_10065112 399
90 3300012841 Ga0160444_100042 Ga0160444_10004293 399
91 3300012846 Ga0160433_100052 Ga0160433_10005269 399
92 3300012857 Ga0160435_1000046 Ga0160435_100004623 399
93 3300012858 Ga0160457_1000001 Ga0160457_1000001262 399
94 3300012858 Ga0160457_1001994 Ga0160457_10019943 399
95 3300042603 Ga0466714_136997 Ga0466714_136997_1834_3033 399
96 3300042605 Ga0466716_037822 Ga0466716_037822_14078_15277 399
97 3300042615 Ga0466711_271191 Ga0466711_271191_167_1366 399
98 3300042619 Ga0466726_395472 Ga0466726_395472_237_1436 399
99 3300042624 Ga0466735_113613 Ga0466735_113613_14207_15406 399
100 3300042652 Ga0466708_211985 Ga0466708_211985_4182_5381 399
101 3300042655 Ga0466727_214843 Ga0466727_214843_845_2044 399
102 iso_pr_bacteria 2820196379 2820197574 399
103 3300042605 Ga0466716_342359 Ga0466716_342359_3000_4202 400
104 3300042616 Ga0466715_646891 Ga0466715_646891_2229_3431 400
105 3300042618 Ga0466723_371180 Ga0466723_371180_11992_13194 400
106 3300042624 Ga0466735_159098 Ga0466735_159098_3321_4523 400
107 3300042643 Ga0466704_165666 Ga0466704_165666_143_1345 400
108 3300042648 Ga0466709_073055 Ga0466709_073055_214_1416 400
109 3300042652 Ga0466708_163601 Ga0466708_163601_22060_23262 400
110 iso_pr_bacteria 2597490292 2598962272 400
111 iso_pr_bacteria 2816332478 2818028159 400
112 iso_pr_bacteria 2834852038 2834854529 400
113 iso_pr_bacteria 2854518031 2854520060 400
114 iso_pr_bacteria 2854536247 2854537138 400
115 iso_pr_bacteria 2854548700 2854549113 400
116 iso_pr_bacteria 2858089842 2858092074 400
117 iso_pr_bacteria 2858102877 2858104656 400
118 iso_pr_bacteria 2858105562 2858105709 400
119 iso_pr_bacteria 2858110640 2858113046 400
120 iso_pr_bacteria 2858119979 2858120724 400
121 iso_pr_bacteria 2858129007 2858131236 400
122 iso_pr_bacteria 2868677537 2868679868 400
123 iso_pr_bacteria 2868683769 2868685662 400
124 3300002931 CVPL010W_10001989 CVPL010W_100019893 401
125 3300007140 Ga0102740_1003330 Ga0102740_10033302 401
126 3300009826 Ga0123355_10020085 Ga0123355_100200852 401
127 3300009826 Ga0123355_10083908 Ga0123355_100839084 401
128 3300042605 Ga0466716_152536 Ga0466716_152536_2124_3329 401
129 3300042618 Ga0466723_130028 Ga0466723_130028_435_1640 401
130 3300042636 Ga0466703_064559 Ga0466703_064559_312_1517 401
131 3300042649 Ga0466724_51309 Ga0466724_51309_1724_2929 401
132 iso_pr_bacteria 2579779088 2582238304 401
133 iso_pr_bacteria 2896321640 2896322127 401
134 iso_pr_bacteria 2896330536 2896333989 401
135 iso_pr_bacteria 2896350215 2896353527 401
136 iso_pr_bacteria 2898741527 2898743002 401
137 iso_pr_bacteria 2987037630 2987037867 401
138 3300007106 Ga0104041_1032693 Ga0104041_10326933 402
139 3300007143 Ga0104048_1003111 Ga0104048_10031116 402
140 3300007143 Ga0104048_1022249 Ga0104048_10222493 402
141 3300007153 Ga0104050_1003777 Ga0104050_10037773 402
142 3300010167 Ga0123353_10018735 Ga0123353_100187354 402
143 3300012814 Ga0160453_100001 Ga0160453_100001371 402
144 3300012819 Ga0160468_100143 Ga0160468_10014358 402
145 3300012824 Ga0160469_101026 Ga0160469_1010261 402
146 3300012847 Ga0160445_100417 Ga0160445_1004175 402
147 3300012847 Ga0160445_101315 Ga0160445_1013152 402
148 3300038395 Ga0415639_246503 Ga0415639_246503_321_1529 402
149 3300042597 Ga0466699_347869 Ga0466699_347869_227_1435 402
150 3300042598 Ga0466701_074000 Ga0466701_074000_32_1240 402
151 3300042601 Ga0466707_190491 Ga0466707_190491_188_1396 402
152 iso_pr_bacteria 2820744581 2820745797 402
153 iso_pr_bacteria 8067483258 8067487963 403
154 3300012832 Ga0160458_100140 Ga0160458_10014015 404
155 3300012846 Ga0160433_101315 Ga0160433_1013153 404
156 3300002450 JGI24695J34938_10017618 JGI24695J34938_100176182 405
157 3300002450 JGI24695J34938_10058052 JGI24695J34938_100580521 405
158 3300007129 Ga0102734_1000951 Ga0102734_10009513 405
159 iso_pr_bacteria 2820611732 2820613042 407
160 3300009826 Ga0123355_10001261 Ga0123355_1000126110 409
161 3300042621 Ga0466729_018888 Ga0466729_018888_6504_7739 411
162 iso_pr_bacteria 651324000 651477235 411
163 3300010049 Ga0123356_10071380 Ga0123356_100713803 412
164 3300012837 Ga0160455_100185 Ga0160455_10018539 412
165 3300042612 Ga0466705_257271 Ga0466705_257271_4139_5377 412
166 3300010049 Ga0123356_10025456 Ga0123356_100254564 413
167 3300010167 Ga0123353_10005109 Ga0123353_100051093 413
168 3300042622 Ga0466731_135492 Ga0466731_135492_1364_2623 419
169 3300042596 Ga0466696_139793 Ga0466696_139793_17622_18893 423
170 3300042600 Ga0466700_447152 Ga0466700_447152_1191_2462 423
171 3300042636 Ga0466703_097090 Ga0466703_097090_6550_7932 460
172 3300042619 Ga0466726_005761 Ga0466726_005761_317_1705 462

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00155 Aminotran_1_2 Aminotransferase class I and II 99 446 0.96
PF01041 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase family 176 270 0.76

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.