Protein Family IF08177

Metagenome Isolate
170 Members
71 Samples
155 Scaffolds
371.64 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_347073|Ga0466723_347073_18189_19457
Length
422 aa
Sequence
LLPDAGASSLDNDFSRQNAMLNDAMRTKFFHQGKEPITQMKKKVLFIDRDGTLIMEPPVTFQVDTLEQLMFLPGVMRNLYFICKNLDFELVIVTNQDGLGTPSYPQENFDCVQEKMLEVFAGEGVIFDHILVDPSFPEDNSPNRKPQTGMLKEYMTGDYDLENSYVIGDRKTDLELAANLGCKGILIAADEFAMESAPDLYEAKEYASYRKDRFHIFNSWDKIKDFLFAGERVATVQRTTKETAIYVGLNLDGNGTCDISTGIGFFDHMLEQIGKHGGLDLTIKVKGDLHVDEHHTIEDTAIALGEALSTALGDKRGIERYGYCLPMDDCLCSVALDFGGRAWLVWDAKFKREKIGEMPTEMFLHFFKSLSDAAKMNLHIKAEGENEHHKAEGIFKALARAIKMAIRRDVYKYDLPSTKGVL

📊 Sample Types

Isolate 8.8%
Metagenome 91.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 28.4%
Kalotermitidae 20.9%
Blattidae 11.9%
Unclassified 9.0%
Culicidae 7.5%
Termopsidae 6.0%
Passalidae 4.5%
Rhinotermitidae 4.5%
Armadillidiidae 3.0%
Hydrophilidae 3.0%
Hodotermitidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 167
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 2548876789 Xanthomonas sacchari NCPPB 4393 Isolate
3 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
4 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
5 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
6 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
7 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
8 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
9 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
10 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
11 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
12 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
13 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
14 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
15 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
16 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
17 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
18 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
19 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
20 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
21 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
22 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
27 2923982719 Parabacteroides sp. 52 Isolate Blattidae
28 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
29 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
30 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
31 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
32 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
33 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
34 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
35 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
36 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
37 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
38 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
39 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
40 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
41 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
42 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
43 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
44 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
45 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
46 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
47 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
48 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
49 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
50 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
51 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
52 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
53 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
54 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
55 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
56 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
57 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
58 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
59 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
60 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
61 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
62 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
63 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
64 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
65 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
66 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
67 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
68 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
69 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
70 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
71 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_293286 3300042612 Bacteria 13296
2 Ga0466733_141352 3300042659 Bacteria 6457
3 Ga0123356_10062443 3300010049 Bacteria 3480
4 Ga0123353_10092252 3300010167 Bacteria 4879
5 Ga0123353_10108287 3300010167 Bacteria 4479
6 Ga0123353_10205553 3300010167 Bacteria 3094
7 Ga0123354_10003453 3300010882 Bacteria 21822
8 Ga0466719_420236 3300042606 Bacteria 3818
9 Ga0466722_207195 3300042609 Bacteria 15872
10 Ga0160444_100685 3300012841 Bacteria 10975
11 Ga0160435_1000148 3300012857 Bacteria 39041
12 Ga0466710_277295 3300042613 Bacteria 1758
13 Ga0466711_020216 3300042615 Bacteria 9627
14 Ga0466723_221077 3300042618 Bacteria 5910
15 Ga0466703_084836 3300042636 Bacteria 30933
16 Ga0466703_293285 3300042636 Bacteria 6746
17 Ga0466709_122308 3300042648 Bacteria 10577
18 Ga0466725_326056 3300042654 Bacteria 13548
19 2227513823 2225789004 Bacteria 3495
20 IMNBL1DRAFT_c0011007 3300000062 Bacteria 4267
21 JGI24702J35022_10043946 3300002462 Bacteria 2381
22 Ga0123353_10270298 3300010167 Bacteria 2620
23 Ga0123354_10004737 3300010882 Bacteria 19419
24 Ga0123354_10051817 3300010882 Bacteria 6192
25 Ga0123354_10185935 3300010882 Bacteria 2350
26 Ga0466706_192130 3300042599 Bacteria 1491
27 Ga0466700_363602 3300042600 Bacteria 1468
28 Ga0466707_242449 3300042601 Bacteria 5110
29 Ga0466707_325747 3300042601 Bacteria 5667
30 Ga0466713_095051 3300042602 Bacteria 4877
31 Ga0466713_138199 3300042602 Bacteria 5223
32 Ga0466698_083396 3300042610 Bacteria 3231
33 Ga0160430_100001 3300012852 Bacteria 595720
34 Ga0160457_1000051 3300012858 Bacteria 188725
35 Ga0466696_429551 3300042596 Bacteria 3422
36 Ga0466696_458003 3300042596 Bacteria 2263
37 Ga0466710_145292 3300042613 Bacteria 1214
38 Ga0466715_221782 3300042616 Bacteria 1901
39 Ga0466723_060443 3300042618 Bacteria 6130
40 Ga0466726_187569 3300042619 Bacteria 11140
41 Ga0466704_239506 3300042643 Unclassified 22021
42 Ga0466724_68702 3300042649 Bacteria 40617
43 IMNBGM34_c000382 3300000036 Bacteria 12547
44 IMNBL1DRAFT_c0001790 3300000062 Bacteria 15722
45 JGI24705J35276_12161465 3300002504 Bacteria 1235
46 Ga0068302_10088039 3300005071 Bacteria 3808
47 Ga0466705_226303 3300042612 Bacteria 21197
48 Ga0466733_035383 3300042659 Bacteria 60826
49 Ga0123357_10180894 3300009784 Bacteria 2462
50 Ga0123353_10000022 3300010167 Bacteria 176395
51 Ga0123353_10740976 3300010167 Bacteria 1369
52 Ga0466714_113455 3300042603 Bacteria 2502
53 Ga0466716_362136 3300042605 Bacteria 18292
54 Ga0466719_127199 3300042606 Bacteria 13882
55 Ga0466719_546969 3300042606 Bacteria 1910
56 Ga0160472_100392 3300012839 Bacteria 36004
57 Ga0466696_155579 3300042596 Bacteria 10369
58 Ga0466711_109167 3300042615 Bacteria 3594
59 Ga0466703_025076 3300042636 Bacteria 6227
60 Ga0466704_450798 3300042643 Bacteria 2361
61 Ga0466727_078486 3300042655 Bacteria 1453
62 IMNBL1DRAFT_c0014699 3300000062 Bacteria 3436
63 JGI24702J35022_10017329 3300002462 Bacteria 3937
64 Ga0123357_10000608 3300009784 Bacteria 35490
65 Ga0466705_064619 3300042612 Unclassified 5134
66 Ga0466733_078603 3300042659 Bacteria 14665
67 Ga0466701_016089 3300042598 Bacteria 3759
68 Ga0466700_323712 3300042600 Bacteria 6893
69 Ga0466707_224834 3300042601 Bacteria 36207
70 Ga0466713_120509 3300042602 Bacteria 47742
71 Ga0160434_100075 3300012850 Bacteria 69288
72 Ga0466690_120118 3300042590 Bacteria 5333
73 Ga0466692_114922 3300042591 Bacteria 1226
74 Ga0466696_344957 3300042596 Bacteria 38008
75 Ga0466734_076669 3300042623 Bacteria 1092
76 Ga0466703_186004 3300042636 Bacteria 13054
77 Ga0466703_422910 3300042636 Bacteria 7982
78 Ga0466704_195782 3300042643 Bacteria 3403
79 IMNBL1DRAFT_c0002584 3300000062 Bacteria 12465
80 IMNBL1DRAFT_c0005045 3300000062 Bacteria 7691
81 JGI24705J35276_12222747 3300002504 Bacteria 2447
82 Ga0072941_1193537 3300005201 Bacteria 5030
83 Ga0123357_10001366 3300009784 Bacteria 25817
84 Ga0466733_004143 3300042659 Bacteria 13018
85 Ga0466733_124575 3300042659 Bacteria 2681
86 Ga0123357_10160619 3300009784 Bacteria 2695
87 Ga0123354_10141904 3300010882 Bacteria 2965
88 Ga0466706_244303 3300042599 Bacteria 41796
89 Ga0466700_220113 3300042600 Bacteria 3836
90 Ga0466700_324769 3300042600 Bacteria 1809
91 Ga0466716_200996 3300042605 Bacteria 14336
92 Ga0466722_252821 3300042609 Bacteria 235840
93 Ga0160441_100184 3300012825 Bacteria 67229
94 Ga0466715_022606 3300042616 Bacteria 1406
95 Ga0466715_393622 3300042616 Bacteria 46255
96 Ga0466723_033742 3300042618 Bacteria 108590
97 Ga0466728_324182 3300042620 Bacteria 12575
98 Ga0466704_140571 3300042643 Bacteria 5570
99 Ga0466704_579595 3300042643 Bacteria 7541
100 2227664357 2225789004 Bacteria 1931
101 JGI24702J35022_10003939 3300002462 Bacteria 8921
102 JGI24705J35276_12223217 3300002504 Bacteria 2488
103 JGI24696J40584_12955634 3300002834 Bacteria 2885
104 Ga0068305_10085457 3300005083 Bacteria 7438
105 Ga0068305_10228517 3300005083 Bacteria 7910
106 Ga0466705_156500 3300042612 Bacteria 12429
107 Ga0466732_250244 3300042656 Bacteria 11789
108 Ga0123353_10006389 3300010167 Bacteria 15679
109 Ga0466713_013071 3300042602 Bacteria 30342
110 Ga0466713_062124 3300042602 Bacteria 2420
111 Ga0466716_302877 3300042605 Bacteria 19456
112 Ga0466715_347456 3300042616 Bacteria 3522
113 Ga0466728_239511 3300042620 Bacteria 3192
114 Ga0466703_071403 3300042636 Bacteria 2871
115 Ga0466703_099832 3300042636 Bacteria 8599
116 2227100255 2225789004 Bacteria 9612
117 2227538529 2225789004 Bacteria 15771
118 JGI24702J35022_10012718 3300002462 Bacteria 4671
119 JGI24699J35502_11134037 3300002509 Bacteria 25927
120 Ga0068305_10005336 3300005083 Bacteria 80650
121 Ga0466733_046022 3300042659 Bacteria 1939
122 Ga0466733_169588 3300042659 Bacteria 6735
123 Ga0123357_10011389 3300009784 Bacteria 11399
124 Ga0123356_10013674 3300010049 Bacteria 7821
125 Ga0123353_10143360 3300010167 Bacteria 3824
126 Ga0123353_10241802 3300010167 Bacteria 2804
127 Ga0123354_10043374 3300010882 Bacteria 6915
128 Ga0123354_10307894 3300010882 Bacteria 1485
129 Ga0466706_018051 3300042599 Bacteria 10998
130 Ga0466706_240805 3300042599 Bacteria 51251
131 Ga0466714_028666 3300042603 Bacteria 89946
132 Ga0466722_199038 3300042609 Bacteria 9895
133 Ga0160446_100155 3300012835 Bacteria 54491
134 Ga0466690_193652 3300042590 Bacteria 5035
135 Ga0466693_410924 3300042592 Bacteria 6976
136 Ga0466691_037764 3300042593 Bacteria 8027
137 Ga0466691_108863 3300042593 Bacteria 18837
138 Ga0466726_096510 3300042619 Bacteria 17649
139 Ga0466735_195696 3300042624 Bacteria 4253
140 Ga0466724_67353 3300042649 Bacteria 40151
141 Ga0466708_040628 3300042652 Bacteria 8326
142 JGI24699J35502_11134184 3300002509 Bacteria 47712
143 Ga0466733_091582 3300042659 Bacteria 10688
144 Ga0123357_10178046 3300009784 Bacteria 2493
145 Ga0123353_10125825 3300010167 Unclassified 4119
146 Ga0123353_10180651 3300010167 Bacteria 3340
147 Ga0123354_10240712 3300010882 Bacteria 1862
148 Ga0160447_100193 3300012849 Bacteria 36168
149 Ga0466696_378292 3300042596 Bacteria 11888
150 Ga0466723_347073 3300042618 Bacteria 20744
151 Ga0466734_145707 3300042623 Bacteria 2731
152 Ga0466703_134458 3300042636 Bacteria 22483
153 Ga0466704_458428 3300042643 Bacteria 21257
154 Ga0466709_019530 3300042648 Bacteria 3504
155 Ga0466727_029942 3300042655 Bacteria 6228

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042623 Ga0466734_076669 Ga0466734_076669_110_1081 317
2 3300005201 Ga0072941_1193537 Ga0072941_11935372 318
3 3300005083 Ga0068305_10228517 Ga0068305_102285175 338
4 3300042602 Ga0466713_013071 Ga0466713_013071_11706_12776 341
5 3300005083 Ga0068305_10085457 Ga0068305_100854575 342
6 3300010167 Ga0123353_10205553 Ga0123353_102055533 354
7 3300000062 IMNBL1DRAFT_c0014699 IMNBL1DRAFT_00146992 355
8 3300010167 Ga0123353_10143360 Ga0123353_101433603 355
9 3300042600 Ga0466700_324769 Ga0466700_324769_732_1799 355
10 3300042649 Ga0466724_67353 Ga0466724_67353_33512_34585 357
11 3300042649 Ga0466724_68702 Ga0466724_68702_33770_34843 357
12 iso_pr_bacteria 2548876789 2549846767 357
13 3300012825 Ga0160441_100184 Ga0160441_10018416 358
14 3300012835 Ga0160446_100155 Ga0160446_10015543 358
15 3300012839 Ga0160472_100392 Ga0160472_10039232 358
16 3300012849 Ga0160447_100193 Ga0160447_10019330 358
17 3300012850 Ga0160434_100075 Ga0160434_10007531 358
18 3300012857 Ga0160435_1000148 Ga0160435_100014811 358
19 3300012858 Ga0160457_1000051 Ga0160457_100005123 358
20 3300002462 JGI24702J35022_10003939 JGI24702J35022_100039396 359
21 3300002504 JGI24705J35276_12223217 JGI24705J35276_122232172 359
22 3300012852 Ga0160430_100001 Ga0160430_100001465 360
23 3300012841 Ga0160444_100685 Ga0160444_1006856 362
24 3300042602 Ga0466713_095051 Ga0466713_095051_2451_3542 363
25 3300010167 Ga0123353_10241802 Ga0123353_102418022 365
26 3300042593 Ga0466691_037764 Ga0466691_037764_5028_6140 365
27 3300042636 Ga0466703_134458 Ga0466703_134458_12572_13675 367
28 3300042643 Ga0466704_239506 Ga0466704_239506_12225_13328 367
29 3300042648 Ga0466709_019530 Ga0466709_019530_1165_2268 367
30 3300000062 IMNBL1DRAFT_c0002584 IMNBL1DRAFT_00025847 368
31 3300042596 Ga0466696_344957 Ga0466696_344957_34204_35310 368
32 3300042609 Ga0466722_199038 Ga0466722_199038_7095_8201 368
33 3300042609 Ga0466722_252821 Ga0466722_252821_9902_11011 369
34 3300042655 Ga0466727_029942 Ga0466727_029942_1341_2450 369
35 3300042659 Ga0466733_035383 Ga0466733_035383_19007_20116 369
36 3300042602 Ga0466713_062124 Ga0466713_062124_245_1357 370
37 3300042602 Ga0466713_120509 Ga0466713_120509_27491_28603 370
38 3300042612 Ga0466705_064619 Ga0466705_064619_477_1589 370
39 3300042618 Ga0466723_221077 Ga0466723_221077_2868_3980 370
40 3300042636 Ga0466703_071403 Ga0466703_071403_814_1926 370
41 3300042636 Ga0466703_099832 Ga0466703_099832_7107_8219 370
42 3300000036 IMNBGM34_c000382 IMNBGM34_00038210 371
43 3300010167 Ga0123353_10108287 Ga0123353_101082874 371
44 3300042600 Ga0466700_363602 Ga0466700_363602_222_1337 371
45 3300042601 Ga0466707_242449 Ga0466707_242449_2279_3427 371
46 3300042605 Ga0466716_200996 Ga0466716_200996_9642_10757 371
47 3300042605 Ga0466716_362136 Ga0466716_362136_394_1509 371
48 3300042615 Ga0466711_109167 Ga0466711_109167_1775_2890 371
49 3300042616 Ga0466715_347456 Ga0466715_347456_121_1236 371
50 3300042619 Ga0466726_096510 Ga0466726_096510_4445_5560 371
51 3300042643 Ga0466704_140571 Ga0466704_140571_4315_5430 371
52 iso_pr_bacteria 2695420317 2695483861 371
53 iso_pr_bacteria 2873600114 2873600362 371
54 iso_pr_bacteria 2873610414 2873610736 371
55 iso_pr_bacteria 2910930387 2910930962 371
56 iso_pr_bacteria 8100157865 8100159931 371
57 3300005071 Ga0068302_10088039 Ga0068302_100880393 372
58 3300042591 Ga0466692_114922 Ga0466692_114922_19_1137 372
59 3300042596 Ga0466696_429551 Ga0466696_429551_1763_2881 372
60 3300042599 Ga0466706_192130 Ga0466706_192130_53_1171 372
61 3300042600 Ga0466700_220113 Ga0466700_220113_373_1491 372
62 3300042600 Ga0466700_323712 Ga0466700_323712_596_1714 372
63 3300042606 Ga0466719_546969 Ga0466719_546969_670_1788 372
64 3300042609 Ga0466722_207195 Ga0466722_207195_3534_4652 372
65 3300042610 Ga0466698_083396 Ga0466698_083396_1049_2167 372
66 3300042612 Ga0466705_156500 Ga0466705_156500_2660_3778 372
67 3300042613 Ga0466710_145292 Ga0466710_145292_67_1185 372
68 3300042613 Ga0466710_277295 Ga0466710_277295_410_1528 372
69 3300042616 Ga0466715_393622 Ga0466715_393622_21778_22896 372
70 3300042620 Ga0466728_239511 Ga0466728_239511_2019_3137 372
71 3300042624 Ga0466735_195696 Ga0466735_195696_1071_2189 372
72 3300042636 Ga0466703_025076 Ga0466703_025076_854_1972 372
73 3300042643 Ga0466704_579595 Ga0466704_579595_3432_4550 372
74 3300042659 Ga0466733_078603 Ga0466733_078603_8157_9275 372
75 3300042659 Ga0466733_141352 Ga0466733_141352_4356_5474 372
76 iso_pr_bacteria 2820759988 2820762144 372
77 2225789004 2227100255 2227483413 373
78 2225789004 2227513823 2228010790 373
79 2225789004 2227664357 2228266573 373
80 3300002462 JGI24702J35022_10012718 JGI24702J35022_100127182 373
81 3300002462 JGI24702J35022_10017329 JGI24702J35022_100173291 373
82 3300002504 JGI24705J35276_12161465 JGI24705J35276_121614651 373
83 3300002504 JGI24705J35276_12222747 JGI24705J35276_122227475 373
84 3300002509 JGI24699J35502_11134037 JGI24699J35502_111340376 373
85 3300002509 JGI24699J35502_11134184 JGI24699J35502_111341845 373
86 3300002834 JGI24696J40584_12955634 JGI24696J40584_129556345 373
87 3300009784 Ga0123357_10000608 Ga0123357_1000060810 373
88 3300009784 Ga0123357_10001366 Ga0123357_100013669 373
89 3300009784 Ga0123357_10011389 Ga0123357_100113897 373
90 3300009784 Ga0123357_10160619 Ga0123357_101606195 373
91 3300009784 Ga0123357_10180894 Ga0123357_101808944 373
92 3300010049 Ga0123356_10013674 Ga0123356_100136747 373
93 3300010167 Ga0123353_10006389 Ga0123353_100063893 373
94 3300010167 Ga0123353_10092252 Ga0123353_100922525 373
95 3300010167 Ga0123353_10125825 Ga0123353_101258252 373
96 3300010167 Ga0123353_10180651 Ga0123353_101806513 373
97 3300010167 Ga0123353_10270298 Ga0123353_102702983 373
98 3300010882 Ga0123354_10003453 Ga0123354_100034537 373
99 3300010882 Ga0123354_10043374 Ga0123354_100433743 373
100 3300010882 Ga0123354_10051817 Ga0123354_100518174 373
101 3300010882 Ga0123354_10141904 Ga0123354_101419044 373
102 3300010882 Ga0123354_10185935 Ga0123354_101859352 373
103 3300010882 Ga0123354_10307894 Ga0123354_103078942 373
104 3300042596 Ga0466696_458003 Ga0466696_458003_161_1282 373
105 3300042599 Ga0466706_244303 Ga0466706_244303_33696_34817 373
106 3300042601 Ga0466707_325747 Ga0466707_325747_3330_4451 373
107 3300042616 Ga0466715_221782 Ga0466715_221782_366_1487 373
108 3300042623 Ga0466734_145707 Ga0466734_145707_565_1686 373
109 3300042636 Ga0466703_084836 Ga0466703_084836_7436_8557 373
110 3300042636 Ga0466703_186004 Ga0466703_186004_8463_9584 373
111 3300042636 Ga0466703_293285 Ga0466703_293285_532_1653 373
112 3300042648 Ga0466709_122308 Ga0466709_122308_9220_10341 373
113 3300042659 Ga0466733_124575 Ga0466733_124575_1342_2463 373
114 3300000062 IMNBL1DRAFT_c0005045 IMNBL1DRAFT_00050455 374
115 3300000062 IMNBL1DRAFT_c0011007 IMNBL1DRAFT_00110072 374
116 3300010049 Ga0123356_10062443 Ga0123356_100624433 374
117 3300010882 Ga0123354_10004737 Ga0123354_1000473714 374
118 3300010882 Ga0123354_10240712 Ga0123354_102407122 374
119 3300042596 Ga0466696_155579 Ga0466696_155579_4482_5606 374
120 3300042596 Ga0466696_378292 Ga0466696_378292_6367_7491 374
121 3300042606 Ga0466719_127199 Ga0466719_127199_2947_4071 374
122 3300042606 Ga0466719_420236 Ga0466719_420236_1290_2414 374
123 3300042618 Ga0466723_060443 Ga0466723_060443_4255_5379 374
124 3300042636 Ga0466703_422910 Ga0466703_422910_3204_4328 374
125 3300042652 Ga0466708_040628 Ga0466708_040628_3653_4777 374
126 3300000062 IMNBL1DRAFT_c0001790 IMNBL1DRAFT_000179013 375
127 3300009784 Ga0123357_10178046 Ga0123357_101780463 375
128 3300042592 Ga0466693_410924 Ga0466693_410924_1155_2282 375
129 3300042593 Ga0466691_108863 Ga0466691_108863_4795_5922 375
130 3300042599 Ga0466706_018051 Ga0466706_018051_1346_2473 375
131 3300042599 Ga0466706_240805 Ga0466706_240805_43420_44547 375
132 3300042603 Ga0466714_028666 Ga0466714_028666_77210_78337 375
133 3300042603 Ga0466714_113455 Ga0466714_113455_366_1493 375
134 3300042612 Ga0466705_226303 Ga0466705_226303_317_1444 375
135 3300042620 Ga0466728_324182 Ga0466728_324182_785_1912 375
136 3300042643 Ga0466704_458428 Ga0466704_458428_511_1638 375
137 3300042659 Ga0466733_169588 Ga0466733_169588_2124_3251 375
138 iso_pr_bacteria 2820789850 2820792400 375
139 3300042590 Ga0466690_120118 Ga0466690_120118_2705_3835 376
140 3300042598 Ga0466701_016089 Ga0466701_016089_1764_2894 376
141 3300042602 Ga0466713_138199 Ga0466713_138199_879_2009 376
142 3300042655 Ga0466727_078486 Ga0466727_078486_168_1298 376
143 3300042656 Ga0466732_250244 Ga0466732_250244_8094_9224 376
144 3300042659 Ga0466733_046022 Ga0466733_046022_486_1616 376
145 3300042659 Ga0466733_091582 Ga0466733_091582_1511_2641 376
146 iso_pr_bacteria 2923982719 2923983989 376
147 iso_pr_bacteria 2940195863 2940196725 376
148 iso_pr_bacteria 2940199050 2940201941 376
149 iso_pr_bacteria 2940202316 2940204525 376
150 iso_pr_bacteria 2940209341 2940209870 376
151 iso_pr_bacteria 2940346213 2940348881 376
152 iso_pr_bacteria 2940371297 2940373666 376
153 3300042616 Ga0466715_022606 Ga0466715_022606_82_1218 378
154 2225789004 2227538529 2228058194 379
155 3300042619 Ga0466726_187569 Ga0466726_187569_520_1695 381
156 3300042615 Ga0466711_020216 Ga0466711_020216_216_1364 382
157 3300042643 Ga0466704_195782 Ga0466704_195782_775_1929 384
158 3300005083 Ga0068305_10005336 Ga0068305_100053366 385
159 3300042612 Ga0466705_293286 Ga0466705_293286_2725_3882 385
160 3300042659 Ga0466733_004143 Ga0466733_004143_11186_12349 387
161 3300042590 Ga0466690_193652 Ga0466690_193652_1782_2948 388
162 3300042605 Ga0466716_302877 Ga0466716_302877_10365_11531 388
163 3300042618 Ga0466723_033742 Ga0466723_033742_59612_60778 388
164 3300002462 JGI24702J35022_10043946 JGI24702J35022_100439462 390
165 3300042654 Ga0466725_326056 Ga0466725_326056_1856_3037 393
166 3300042601 Ga0466707_224834 Ga0466707_224834_7962_9152 396
167 3300010167 Ga0123353_10740976 Ga0123353_107409762 397
168 3300042643 Ga0466704_450798 Ga0466704_450798_513_1715 400
169 3300010167 Ga0123353_10000022 Ga0123353_1000002219 406
170 3300042618 Ga0466723_347073 Ga0466723_347073_18189_19457 422

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00475 IGPD Imidazoleglycerol-phosphate dehydratase 261 402 0.99
PF13242 Hydrolase_like HAD-hyrolase-like 144 195 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.71 0.76 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.