Protein Family IF08166

Metagenome Isolate
129 Members
45 Samples
125 Scaffolds
326.95 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_329121|Ga0466723_329121_3749_4918
Length
389 aa
Sequence
MSIPFLLAPMAEISHRALRELIESFGNGAAEYYTEMISAGALVGGGPFEKWYTDPGPCPQKLVYQLVGADREQLAKAASLLDKLECNDPRTGEGGCLGIDINMGCAAPAITRTGAGVRWMEDMDKAGGMIALVRKQVKRRLSVKLRLGFVSRGGSEEAAFGYLVRFCRRLEAEGVELITLHPRTAKEKFRRSARWEYVSALRRELGIPVAGNGGIMSAKEMLAKSADCDAVMIGRLAVTKPWIFAQAHALEQNGKLAPDNGQSTNPAEWTGYGPACESTAAQADGVWTLCNEPEKPHPAPGFPAPPCLEKIGLNFLELLARYQPPEFRLSRARRFFNCFCDNLTWGNHVKNLLNREKSLGEIERVWKDYFAANPEENKTLEALVNSIEN

📊 Sample Types

Isolate 3.1%
Metagenome 96.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 46.5%
Kalotermitidae 27.9%
Unclassified 11.6%
Termopsidae 7.0%
Rhinotermitidae 4.7%
Hodotermitidae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 126
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
3 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
4 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
5 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
6 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
7 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
8 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
9 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
10 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
11 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
12 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
13 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
14 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
15 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
16 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
17 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
18 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
19 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
20 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
21 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
22 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
23 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
24 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
25 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
26 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
29 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
30 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
31 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
32 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
33 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
34 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
35 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
36 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
37 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
38 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
39 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
40 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
41 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
42 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
43 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
44 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
45 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10000059 3300010049 Bacteria 117133
2 Ga0123353_10109080 3300010167 Bacteria 4460
3 Ga0466720_024952 3300042607 Bacteria 12599
4 Ga0466711_119937 3300042615 Bacteria 22651
5 Ga0466711_143272 3300042615 Bacteria 2298
6 Ga0466715_195209 3300042616 Bacteria 10518
7 Ga0466715_288599 3300042616 Bacteria 3823
8 Ga0466723_329121 3300042618 Bacteria 11043
9 Ga0466726_286903 3300042619 Bacteria 1397
10 JGI24698J34947_10032823 3300002449 Bacteria 2724
11 JGI24698J34947_10065414 3300002449 Bacteria 1773
12 Ga0072941_1119427 3300005201 Bacteria 2745
13 Ga0123357_10000140 3300009784 Bacteria 63300
14 Ga0466694_245438 3300042594 Bacteria 3328
15 Ga0466696_216914 3300042596 Bacteria 9997
16 Ga0466699_042022 3300042597 Bacteria 4178
17 Ga0466699_214625 3300042597 Bacteria 21334
18 Ga0466699_312204 3300042597 Bacteria 1776
19 Ga0466735_074936 3300042624 Bacteria 1740
20 Ga0466704_170173 3300042643 Bacteria 13167
21 Ga0466709_063776 3300042648 Bacteria 6904
22 Ga0466705_100998 3300042612 Bacteria 6114
23 Ga0466720_050818 3300042607 Bacteria 9369
24 Ga0466720_058071 3300042607 Bacteria 29909
25 Ga0466715_242198 3300042616 Bacteria 5323
26 Ga0466718_089511 3300042617 Bacteria 5375
27 JGI24698J34947_10004411 3300002449 Bacteria 7662
28 Ga0072940_1031960 3300005200 Bacteria 9067
29 Ga0264413_127367 3300024493 Bacteria 1208
30 Ga0466693_084313 3300042592 Bacteria 21473
31 Ga0466696_076320 3300042596 Bacteria 10432
32 Ga0466699_069194 3300042597 Bacteria 4915
33 Ga0466699_326597 3300042597 Bacteria 2471
34 Ga0466735_218783 3300042624 Bacteria 1336
35 Ga0466727_111701 3300042655 Bacteria 1135
36 Ga0466705_016047 3300042612 Bacteria 3580
37 Ga0466732_077440 3300042656 Bacteria 3966
38 Ga0123353_11176694 3300010167 Bacteria 1009
39 Ga0466720_012183 3300042607 Bacteria 3105
40 Ga0466711_195788 3300042615 Bacteria 43179
41 Ga0466718_105174 3300042617 Bacteria 2043
42 Ga0466723_372532 3300042618 Bacteria 4311
43 JGI24698J34947_10035961 3300002449 Bacteria 2581
44 JGI24700J35501_10930476 3300002508 Bacteria 14577
45 Ga0264413_115075 3300024493 Bacteria 4918
46 Ga0466735_120167 3300042624 Unclassified 8916
47 Ga0466732_013058 3300042656 Bacteria 11491
48 Ga0123353_10126154 3300010167 Bacteria 4113
49 Ga0466706_260476 3300042599 Bacteria 1527
50 Ga0466707_022031 3300042601 Bacteria 1516
51 Ga0466719_357893 3300042606 Bacteria 2602
52 Ga0466720_005069 3300042607 Bacteria 9617
53 Ga0466720_008269 3300042607 Bacteria 14083
54 Ga0466712_002993 3300042614 Bacteria 4610
55 Ga0466712_064553 3300042614 Bacteria 17182
56 Ga0466718_044351 3300042617 Unclassified 7174
57 Ga0466726_206818 3300042619 Bacteria 1188
58 Ga0466726_231713 3300042619 Bacteria 6017
59 AustNasuHG_c1000642 3300000089 Bacteria 12343
60 AustNasuHG_c1005934 3300000089 Bacteria 4367
61 JGI24698J34947_10006021 3300002449 Bacteria 6659
62 JGI24698J34947_10050310 3300002449 Bacteria 2103
63 Ga0072940_1034741 3300005200 Bacteria 2242
64 Ga0072941_1000915 3300005201 Bacteria 20868
65 Ga0072941_1059139 3300005201 Bacteria 3910
66 Ga0415639_002790 3300038395 Bacteria 1264
67 Ga0466690_145052 3300042590 Bacteria 4295
68 Ga0466699_077308 3300042597 Bacteria 23688
69 Ga0123353_10060642 3300010167 Bacteria 6066
70 Ga0466720_046265 3300042607 Bacteria 10532
71 Ga0466720_154320 3300042607 Bacteria 1495
72 Ga0466722_000469 3300042609 Bacteria 4191
73 Ga0466712_124041 3300042614 Bacteria 18962
74 Ga0466718_026054 3300042617 Bacteria 12053
75 Ga0466723_195871 3300042618 Bacteria 20538
76 Ga0466723_340850 3300042618 Bacteria 7615
77 Ga0466728_037216 3300042620 Bacteria 9530
78 Ga0466728_144348 3300042620 Bacteria 12365
79 Ga0072941_1073501 3300005201 Bacteria 5723
80 Ga0466694_083444 3300042594 Bacteria 6986
81 Ga0466699_345647 3300042597 Bacteria 2205
82 Ga0466703_091206 3300042636 Bacteria 37744
83 Ga0123354_10012082 3300010882 Bacteria 13367
84 Ga0466720_085663 3300042607 Bacteria 7945
85 Ga0466712_188876 3300042614 Bacteria 23335
86 Ga0466712_260420 3300042614 Bacteria 19474
87 Ga0466728_141462 3300042620 Bacteria 6258
88 Ga0466728_418874 3300042620 Bacteria 25820
89 AustNasuHG_c1002303 3300000089 Bacteria 6890
90 JGI24698J34947_10073758 3300002449 Bacteria 1627
91 JGI24698J34947_10109661 3300002449 Bacteria 1221
92 Ga0072941_1046087 3300005201 Bacteria 2846
93 Ga0264413_115076 3300024493 Bacteria 3007
94 Ga0466694_146023 3300042594 Bacteria 7613
95 Ga0466735_086455 3300042624 Bacteria 7149
96 Ga0466703_205060 3300042636 Bacteria 3931
97 Ga0466732_063514 3300042656 Bacteria 1455
98 Ga0466732_091197 3300042656 Bacteria 3577
99 Ga0466712_034210 3300042614 Bacteria 1458
100 Ga0466711_010434 3300042615 Bacteria 6246
101 JGI24699J35502_11052007 3300002509 Bacteria 1660
102 Ga0072941_1019234 3300005201 Bacteria 13089
103 Ga0264413_119457 3300024493 Bacteria 12229
104 Ga0415639_001709 3300038395 Bacteria 19835
105 Ga0466694_099814 3300042594 Bacteria 1947
106 Ga0466729_248553 3300042621 Bacteria 1857
107 Ga0466727_095687 3300042655 Bacteria 8107
108 Ga0123356_10023667 3300010049 Bacteria 5778
109 Ga0466707_167682 3300042601 Bacteria 13743
110 Ga0466720_114444 3300042607 Bacteria 17733
111 Ga0466722_019048 3300042609 Bacteria 3053
112 Ga0466712_177021 3300042614 Bacteria 1381
113 Ga0466712_226351 3300042614 Unclassified 1780
114 Ga0466718_073358 3300042617 Bacteria 27999
115 JGI24698J34947_10025589 3300002449 Bacteria 3141
116 JGI24698J34947_10027609 3300002449 Bacteria 3011
117 JGI24695J34938_10000419 3300002450 Bacteria 41287
118 Ga0072941_1011759 3300005201 Bacteria 16412
119 Ga0264413_121691 3300024493 Bacteria 2755
120 Ga0466690_126576 3300042590 Bacteria 9739
121 Ga0466695_068957 3300042595 Bacteria 62949
122 Ga0466731_196768 3300042622 Bacteria 2163
123 Ga0466735_156920 3300042624 Bacteria 2527
124 Ga0466708_273325 3300042652 Bacteria 30455
125 Ga0466727_311354 3300042655 Bacteria 2397

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300024493 Ga0264413_115075 Ga0264413_1150754 284
2 3300024493 Ga0264413_121691 Ga0264413_1216911 284
3 3300042614 Ga0466712_002993 Ga0466712_002993_3358_4422 290
4 3300010167 Ga0123353_11176694 Ga0123353_111766942 296
5 3300042617 Ga0466718_089511 Ga0466718_089511_965_1975 303
6 3300024493 Ga0264413_115076 Ga0264413_1150762 304
7 iso_pr_bacteria 2781125688 2781422598 304
8 3300010049 Ga0123356_10023667 Ga0123356_100236672 305
9 3300010882 Ga0123354_10012082 Ga0123354_1001208211 305
10 3300042614 Ga0466712_226351 Ga0466712_226351_591_1508 305
11 3300042594 Ga0466694_245438 Ga0466694_245438_1337_2257 306
12 3300042597 Ga0466699_312204 Ga0466699_312204_790_1752 306
13 3300005201 Ga0072941_1000915 Ga0072941_100091512 308
14 3300042656 Ga0466732_077440 Ga0466732_077440_163_1089 308
15 3300042597 Ga0466699_069194 Ga0466699_069194_2486_3415 309
16 3300042595 Ga0466695_068957 Ga0466695_068957_46357_47289 310
17 3300005201 Ga0072941_1059139 Ga0072941_10591393 311
18 3300024493 Ga0264413_127367 Ga0264413_1273671 311
19 3300042617 Ga0466718_105174 Ga0466718_105174_726_1661 311
20 3300010167 Ga0123353_10109080 Ga0123353_101090803 312
21 3300042615 Ga0466711_010434 Ga0466711_010434_764_1702 312
22 3300042618 Ga0466723_340850 Ga0466723_340850_567_1505 312
23 3300042624 Ga0466735_218783 Ga0466735_218783_269_1207 312
24 3300002449 JGI24698J34947_10065414 JGI24698J34947_100654142 313
25 3300005201 Ga0072941_1019234 Ga0072941_10192343 313
26 3300042590 Ga0466690_145052 Ga0466690_145052_208_1206 313
27 3300042607 Ga0466720_085663 Ga0466720_085663_6923_7912 313
28 3300042609 Ga0466722_019048 Ga0466722_019048_886_1902 313
29 3300042619 Ga0466726_231713 Ga0466726_231713_376_1317 313
30 3300002449 JGI24698J34947_10109661 JGI24698J34947_101096611 314
31 3300042607 Ga0466720_058071 Ga0466720_058071_15535_16479 314
32 3300042614 Ga0466712_124041 Ga0466712_124041_17787_18731 314
33 3300042615 Ga0466711_195788 Ga0466711_195788_31389_32333 314
34 3300042620 Ga0466728_141462 Ga0466728_141462_1586_2530 314
35 iso_pr_bacteria 2781125691 2781429374 315
36 3300005200 Ga0072940_1031960 Ga0072940_103196011 316
37 3300042601 Ga0466707_022031 Ga0466707_022031_472_1437 316
38 3300042606 Ga0466719_357893 Ga0466719_357893_1326_2297 316
39 3300042607 Ga0466720_012183 Ga0466720_012183_1998_2948 316
40 3300042614 Ga0466712_260420 Ga0466712_260420_4155_5105 316
41 3300042618 Ga0466723_195871 Ga0466723_195871_4693_5643 316
42 3300042622 Ga0466731_196768 Ga0466731_196768_1040_1990 316
43 3300042615 Ga0466711_143272 Ga0466711_143272_975_1928 317
44 3300042616 Ga0466715_195209 Ga0466715_195209_6829_7782 317
45 3300000089 AustNasuHG_c1000642 AustNasuHG_10006421 318
46 3300010167 Ga0123353_10126154 Ga0123353_101261542 318
47 3300005201 Ga0072941_1073501 Ga0072941_10735016 319
48 3300042617 Ga0466718_073358 Ga0466718_073358_11699_12721 319
49 3300000089 AustNasuHG_c1005934 AustNasuHG_10059344 320
50 3300038395 Ga0415639_001709 Ga0415639_001709_12060_13022 320
51 3300042636 Ga0466703_205060 Ga0466703_205060_2619_3581 320
52 3300042652 Ga0466708_273325 Ga0466708_273325_7986_8948 320
53 3300002449 JGI24698J34947_10073758 JGI24698J34947_100737582 321
54 3300042599 Ga0466706_260476 Ga0466706_260476_289_1254 321
55 3300042614 Ga0466712_034210 Ga0466712_034210_12_977 321
56 3300042616 Ga0466715_242198 Ga0466715_242198_1621_2586 321
57 3300042624 Ga0466735_086455 Ga0466735_086455_386_1351 321
58 3300042624 Ga0466735_120167 Ga0466735_120167_5016_5981 321
59 3300042624 Ga0466735_074936 Ga0466735_074936_124_1092 322
60 iso_pr_bacteria 2819994798 2819996754 322
61 3300002508 JGI24700J35501_10930476 JGI24700J35501_1093047610 323
62 3300042619 Ga0466726_286903 Ga0466726_286903_229_1200 323
63 3300002449 JGI24698J34947_10004411 JGI24698J34947_100044111 324
64 3300042590 Ga0466690_126576 Ga0466690_126576_5489_6463 324
65 3300042655 Ga0466727_311354 Ga0466727_311354_861_1835 324
66 3300002450 JGI24695J34938_10000419 JGI24695J34938_1000041941 326
67 3300010049 Ga0123356_10000059 Ga0123356_10000059110 326
68 3300038395 Ga0415639_002790 Ga0415639_002790_92_1072 326
69 3300042597 Ga0466699_326597 Ga0466699_326597_1450_2430 326
70 3300042614 Ga0466712_188876 Ga0466712_188876_5852_6832 326
71 3300000089 AustNasuHG_c1002303 AustNasuHG_10023039 327
72 3300042594 Ga0466694_099814 Ga0466694_099814_531_1514 327
73 3300042617 Ga0466718_026054 Ga0466718_026054_7006_7989 327
74 3300042620 Ga0466728_144348 Ga0466728_144348_4261_5244 327
75 3300042643 Ga0466704_170173 Ga0466704_170173_4493_5476 327
76 3300042594 Ga0466694_083444 Ga0466694_083444_4864_5850 328
77 3300005201 Ga0072941_1046087 Ga0072941_10460871 329
78 3300042620 Ga0466728_418874 Ga0466728_418874_5369_6358 329
79 3300042655 Ga0466727_095687 Ga0466727_095687_4636_5625 329
80 3300042607 Ga0466720_154320 Ga0466720_154320_212_1252 330
81 3300042617 Ga0466718_044351 Ga0466718_044351_5476_6468 330
82 3300042621 Ga0466729_248553 Ga0466729_248553_629_1621 330
83 3300042656 Ga0466732_013058 Ga0466732_013058_5688_6680 330
84 3300002449 JGI24698J34947_10027609 JGI24698J34947_100276091 331
85 3300042597 Ga0466699_042022 Ga0466699_042022_1177_2172 331
86 3300042648 Ga0466709_063776 Ga0466709_063776_5261_6256 331
87 3300042596 Ga0466696_076320 Ga0466696_076320_1388_2410 332
88 3300042656 Ga0466732_063514 Ga0466732_063514_402_1400 332
89 3300002449 JGI24698J34947_10050310 JGI24698J34947_100503103 333
90 3300042592 Ga0466693_084313 Ga0466693_084313_608_1609 333
91 3300002449 JGI24698J34947_10006021 JGI24698J34947_100060218 334
92 3300005201 Ga0072941_1011759 Ga0072941_10117599 334
93 3300042656 Ga0466732_091197 Ga0466732_091197_1228_2289 334
94 3300009784 Ga0123357_10000140 Ga0123357_1000014039 335
95 3300010167 Ga0123353_10060642 Ga0123353_100606424 335
96 3300042636 Ga0466703_091206 Ga0466703_091206_23748_24758 336
97 3300042607 Ga0466720_005069 Ga0466720_005069_681_1694 337
98 3300042614 Ga0466712_064553 Ga0466712_064553_15817_16830 337
99 3300042597 Ga0466699_345647 Ga0466699_345647_1066_2082 338
100 3300042607 Ga0466720_024952 Ga0466720_024952_8635_9699 338
101 3300042620 Ga0466728_037216 Ga0466728_037216_1811_2890 338
102 3300024493 Ga0264413_119457 Ga0264413_1194575 339
103 3300042597 Ga0466699_214625 Ga0466699_214625_5474_6493 339
104 iso_pr_bacteria 2781125666 2781343514 340
105 3300002449 JGI24698J34947_10035961 JGI24698J34947_100359612 341
106 3300042619 Ga0466726_206818 Ga0466726_206818_14_1039 341
107 3300042655 Ga0466727_111701 Ga0466727_111701_71_1096 341
108 3300002449 JGI24698J34947_10025589 JGI24698J34947_100255894 342
109 3300042601 Ga0466707_167682 Ga0466707_167682_10383_11417 344
110 3300042607 Ga0466720_050818 Ga0466720_050818_7395_8429 344
111 3300002509 JGI24699J35502_11052007 JGI24699J35502_110520072 346
112 3300042615 Ga0466711_119937 Ga0466711_119937_10142_11185 347
113 3300042607 Ga0466720_046265 Ga0466720_046265_8790_9839 349
114 3300002449 JGI24698J34947_10032823 JGI24698J34947_100328231 350
115 3300005201 Ga0072941_1119427 Ga0072941_11194272 350
116 3300042609 Ga0466722_000469 Ga0466722_000469_2362_3414 350
117 3300042618 Ga0466723_372532 Ga0466723_372532_261_1349 351
118 3300042596 Ga0466696_216914 Ga0466696_216914_2123_3211 352
119 3300042607 Ga0466720_114444 Ga0466720_114444_8048_9109 353
120 3300042607 Ga0466720_008269 Ga0466720_008269_34_1098 354
121 3300042616 Ga0466715_288599 Ga0466715_288599_983_2053 356
122 3300042612 Ga0466705_016047 Ga0466705_016047_2041_3114 357
123 3300042614 Ga0466712_177021 Ga0466712_177021_16_1101 361
124 3300042597 Ga0466699_077308 Ga0466699_077308_5623_6717 364
125 3300042612 Ga0466705_100998 Ga0466705_100998_148_1305 372
126 3300042594 Ga0466694_146023 Ga0466694_146023_802_1929 375
127 3300042624 Ga0466735_156920 Ga0466735_156920_477_1637 375
128 3300005200 Ga0072940_1034741 Ga0072940_10347411 377
129 3300042618 Ga0466723_329121 Ga0466723_329121_3749_4918 389

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01207 Dus Dihydrouridine synthase (Dus) 6 253 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.