Protein Family IF08158

Metagenome Isolate
141 Members
52 Samples
133 Scaffolds
628.9 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_306490|Ga0466723_306490_2663_4684
Length
673 aa
Sequence
MKLEDRFARDTLYTLRSCASHFNRDIKIFVPLQYTFVRLDIFHKILQQYWGYGDFRALQEDIIREVYEGRDVLALMPTGGGKSITFQVPALAKDGICLVITPLIALMKDQVENLKKRDIKALAIHSGMTRKEIDIAFDNAIYGQYKFLYLSPERLGTELFQMRVQKMNVNLLAVDEAHCISQWGYDFRPSYMEIAHARKWLPGVPVLAVTATATPEVARDVMDKLGFRKPNLLQKSFERKNLIYVVREAEDKNTQLLRICNGVPGTGIVYVRSRGNTQEIAAFLNANQISADYYHAGLSAEIRHAKQDDWKQDRTRVMVCTNAFGMGIDKPGVRFVVHVDLPDSIEAYFQEAGRGGRDEKTAYAVLLYNNTDSQKAAQRLRTTFPPVETIREVYQRIYMYFNIPYGAGKGSVFNFSLMDFSVQNKIHSLTAYNALQCLQREGYLELTDELDNPTRVYFTVNRDGLYKVQINNEALDRFIRCLLRAYTGVFTNFVPIDELYLAKLMDVDVAVINDYLLRLSRMRVIDYIPKKRTPLLLFNEERLDEGNLRISKENYGDLKKRYEQRTKAMLHYAANAAQCRSRQLLAYFGETGAASCGRCDVCTGQSAAEVSNYKFNLLSGKIKTLISGNALTLTQCVNSIASNPDDTIKVLRWLIDHDELYETDEGFLQMYDR

📊 Sample Types

Isolate 5.7%
Metagenome 94.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 27.5%
Termitidae 27.5%
Unclassified 15.7%
Rhinotermitidae 5.9%
Termopsidae 5.9%
Formicidae 5.9%
Passalidae 3.9%
Armadillidiidae 2.0%
Daphniidae 2.0%
Blattidae 2.0%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 137
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820748953 Unclassified Bacteroidetes Nt197P4bin17 Isolate Unclassified
2 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 2820767225 Unclassified Bacteroidetes Lab288P3bin34 Isolate Unclassified
7 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
8 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
9 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
10 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
11 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
12 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
13 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
14 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
15 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
16 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
17 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
18 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
19 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
22 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2820736622 Unclassified Bacteroidetes Th196P4bin26 Isolate Unclassified
27 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
28 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
29 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
30 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
31 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
32 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
33 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
34 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
35 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
36 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
37 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 2920168565 Paludibacter sp. 221 Isolate Blattidae
40 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
41 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
42 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
43 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
44 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
45 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
46 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
47 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
48 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
49 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
50 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
51 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
52 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_179271 3300042612 Bacteria 28706
2 Ga0466703_098112 3300042636 Bacteria 4886
3 Ga0466708_395512 3300042652 Bacteria 6294
4 Ga0466690_098343 3300042590 Bacteria 15028
5 Ga0466692_051712 3300042591 Bacteria 14268
6 Ga0466723_042859 3300042618 Bacteria 12089
7 Ga0123353_10133427 3300010167 Bacteria 3984
8 Ga0466713_099770 3300042602 Bacteria 6289
9 Ga0466716_146310 3300042605 Bacteria 4946
10 Ga0466716_302692 3300042605 Bacteria 5186
11 Ga0466716_324965 3300042605 Bacteria 6347
12 IMNBL1DRAFT_c0000270 3300000062 Bacteria 45954
13 JGI24702J35022_10002908 3300002462 Bacteria 10367
14 JGI24705J35276_12237700 3300002504 Bacteria 12632
15 CVPL010W_10012881 3300002931 Bacteria 6533
16 Ga0466697_071249 3300042611 Bacteria 13729
17 Ga0466733_163661 3300042659 Bacteria 7346
18 Ga0466703_181739 3300042636 Bacteria 3471
19 Ga0466708_121875 3300042652 Bacteria 12686
20 Ga0466690_346489 3300042590 Bacteria 8459
21 Ga0466699_083009 3300042597 Bacteria 2311
22 Ga0466712_053307 3300042614 Bacteria 4802
23 Ga0466711_060441 3300042615 Bacteria 8538
24 Ga0466723_034385 3300042618 Bacteria 31971
25 Ga0466707_134560 3300042601 Bacteria 9168
26 Ga0466713_010077 3300042602 Bacteria 20113
27 Ga0466713_109148 3300042602 Bacteria 3728
28 Ga0466721_150892 3300042608 Bacteria 16417
29 2227474637 2225789004 Bacteria 22737
30 IMNBL1DRAFT_c0007408 3300000062 Bacteria 5775
31 IMNBL1DRAFT_c0011803 3300000062 Bacteria 4052
32 IMNBL1DRAFT_c0013817 3300000062 Bacteria 3596
33 Ga0102739_1000052 3300007095 Bacteria 32705
34 Ga0466733_165495 3300042659 Bacteria 19143
35 Ga0466735_102258 3300042624 Bacteria 10912
36 Ga0466703_200042 3300042636 Bacteria 11528
37 Ga0466703_374395 3300042636 Bacteria 6237
38 Ga0466704_357207 3300042643 Unclassified 3456
39 Ga0466709_168950 3300042648 Bacteria 102495
40 Ga0466708_106047 3300042652 Bacteria 9772
41 Ga0466708_365659 3300042652 Bacteria 7609
42 Ga0466690_256695 3300042590 Bacteria 5054
43 Ga0466696_203246 3300042596 Bacteria 9715
44 Ga0466705_453075 3300042612 Bacteria 5396
45 Ga0466711_027006 3300042615 Bacteria 33406
46 Ga0466711_402231 3300042615 Bacteria 13079
47 Ga0466715_004531 3300042616 Bacteria 37567
48 Ga0466715_065073 3300042616 Bacteria 3462
49 Ga0466728_062337 3300042620 Bacteria 36339
50 Ga0123356_10028754 3300010049 Bacteria 5209
51 Ga0123353_10062711 3300010167 Bacteria 5962
52 Ga0102740_1000263 3300007140 Bacteria 14961
53 Ga0466703_018269 3300042636 Bacteria 4281
54 Ga0466703_287183 3300042636 Bacteria 3228
55 Ga0466708_187729 3300042652 Bacteria 24305
56 Ga0466690_018591 3300042590 Unclassified 7559
57 Ga0466690_220752 3300042590 Bacteria 2486
58 Ga0466690_250033 3300042590 Bacteria 18889
59 Ga0466690_332832 3300042590 Bacteria 6459
60 Ga0466696_022759 3300042596 Bacteria 16362
61 Ga0466696_089656 3300042596 Bacteria 11048
62 Ga0466696_343675 3300042596 Bacteria 5082
63 Ga0466715_014882 3300042616 Bacteria 29632
64 Ga0466715_354554 3300042616 Bacteria 7039
65 Ga0466723_048609 3300042618 Bacteria 21511
66 Ga0466723_253378 3300042618 Bacteria 5898
67 Ga0466726_002951 3300042619 Bacteria 2019
68 Ga0466728_029017 3300042620 Bacteria 35653
69 Ga0466719_342847 3300042606 Bacteria 9476
70 2227275225 2225789004 Bacteria 30519
71 Ga0466733_041516 3300042659 Bacteria 12765
72 Ga0466703_008449 3300042636 Bacteria 6025
73 Ga0466703_294972 3300042636 Unclassified 1933
74 Ga0466691_107156 3300042593 Bacteria 9134
75 Ga0466691_166354 3300042593 Bacteria 14141
76 Ga0466715_067917 3300042616 Bacteria 42568
77 Ga0466726_170372 3300042619 Bacteria 8109
78 Ga0466716_039770 3300042605 Bacteria 5468
79 Ga0466716_176457 3300042605 Bacteria 8021
80 Ga0466719_196600 3300042606 Bacteria 3818
81 Ga0466722_124683 3300042609 Bacteria 5503
82 Ga0466722_125322 3300042609 Bacteria 7281
83 Ga0466722_182126 3300042609 Bacteria 7263
84 Ga0466733_008495 3300042659 Bacteria 2130
85 Ga0466729_278721 3300042621 Bacteria 5566
86 Ga0466709_100328 3300042648 Bacteria 4418
87 Ga0466708_341938 3300042652 Bacteria 4794
88 Ga0466727_094701 3300042655 Bacteria 22527
89 Ga0466690_003395 3300042590 Bacteria 2868
90 Ga0466691_088235 3300042593 Bacteria 2751
91 Ga0466705_470164 3300042612 Bacteria 5306
92 Ga0466711_165561 3300042615 Bacteria 2433
93 Ga0466723_086394 3300042618 Bacteria 34576
94 Ga0466723_092677 3300042618 Bacteria 22716
95 Ga0466723_110924 3300042618 Bacteria 6068
96 Ga0466723_306490 3300042618 Bacteria 16637
97 Ga0466728_011149 3300042620 Bacteria 7008
98 Ga0466728_145377 3300042620 Bacteria 4792
99 Ga0123353_10004979 3300010167 Bacteria 17306
100 Ga0123353_10161174 3300010167 Bacteria 3571
101 Ga0466706_218545 3300042599 Bacteria 35347
102 Ga0466717_038867 3300042604 Bacteria 2740
103 Ga0466703_139806 3300042636 Bacteria 2348
104 Ga0466704_032962 3300042643 Bacteria 72585
105 Ga0466704_127187 3300042643 Bacteria 3156
106 Ga0160455_100038 3300012837 Bacteria 295540
107 Ga0466690_263875 3300042590 Bacteria 4043
108 Ga0466691_028750 3300042593 Bacteria 5858
109 Ga0466696_069715 3300042596 Bacteria 52641
110 Ga0466705_399901 3300042612 Bacteria 19786
111 Ga0466711_389055 3300042615 Bacteria 4325
112 Ga0466715_232351 3300042616 Bacteria 13419
113 Ga0466723_202456 3300042618 Bacteria 3827
114 Ga0123355_10004570 3300009826 Bacteria 20126
115 Ga0466701_068575 3300042598 Bacteria 3068
116 Ga0466719_048134 3300042606 Bacteria 8576
117 JGI24698J34947_10043878 3300002449 Unclassified 2290
118 Ga0466703_096460 3300042636 Bacteria 11640
119 Ga0466709_267137 3300042648 Bacteria 107484
120 Ga0466709_296916 3300042648 Bacteria 3536
121 Ga0466690_291135 3300042590 Bacteria 12659
122 Ga0466691_179090 3300042593 Bacteria 9807
123 Ga0466696_368802 3300042596 Bacteria 221772
124 Ga0466715_352693 3300042616 Bacteria 4549
125 Ga0466723_350295 3300042618 Bacteria 15700
126 Ga0466729_051541 3300042621 Bacteria 3490
127 Ga0466729_057120 3300042621 Bacteria 37274
128 Ga0123356_10145953 3300010049 Bacteria 2341
129 Ga0123353_10091573 3300010167 Bacteria 4898
130 Ga0123354_10104514 3300010882 Bacteria 3798
131 Ga0466716_152236 3300042605 Bacteria 2952
132 JGI24702J35022_10037574 3300002462 Bacteria 2586
133 Ga0072941_1022368 3300005201 Bacteria 9399

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042605 Ga0466716_146310 Ga0466716_146310_67_1800 577
2 3300042596 Ga0466696_368802 Ga0466696_368802_112103_114007 590
3 3300042598 Ga0466701_068575 Ga0466701_068575_930_2840 593
4 3300042590 Ga0466690_018591 Ga0466690_018591_1654_3501 597
5 3300042620 Ga0466728_029017 Ga0466728_029017_10486_12279 597
6 3300042659 Ga0466733_008495 Ga0466733_008495_285_2081 598
7 3300002449 JGI24698J34947_10043878 JGI24698J34947_100438781 599
8 3300010167 Ga0123353_10133427 Ga0123353_101334273 599
9 3300042614 Ga0466712_053307 Ga0466712_053307_2731_4632 599
10 3300042616 Ga0466715_232351 Ga0466715_232351_11464_13269 601
11 3300042659 Ga0466733_163661 Ga0466733_163661_5085_6983 601
12 3300042605 Ga0466716_176457 Ga0466716_176457_4012_5925 602
13 3300010167 Ga0123353_10062711 Ga0123353_100627113 604
14 3300042590 Ga0466690_256695 Ga0466690_256695_509_2419 609
15 3300042636 Ga0466703_294972 Ga0466703_294972_14_1846 610
16 3300042652 Ga0466708_365659 Ga0466708_365659_4395_6227 610
17 3300042597 Ga0466699_083009 Ga0466699_083009_43_1947 613
18 3300042648 Ga0466709_296916 Ga0466709_296916_131_1978 615
19 3300042652 Ga0466708_341938 Ga0466708_341938_1271_3118 615
20 3300010049 Ga0123356_10145953 Ga0123356_101459531 616
21 3300042604 Ga0466717_038867 Ga0466717_038867_252_2105 617
22 3300042618 Ga0466723_086394 Ga0466723_086394_29294_31204 617
23 3300010167 Ga0123353_10091573 Ga0123353_100915732 618
24 3300010882 Ga0123354_10104514 Ga0123354_101045145 618
25 3300042593 Ga0466691_107156 Ga0466691_107156_1943_3847 618
26 3300042618 Ga0466723_092677 Ga0466723_092677_3463_5367 618
27 3300002462 JGI24702J35022_10037574 JGI24702J35022_100375742 619
28 3300042611 Ga0466697_071249 Ga0466697_071249_5161_7077 619
29 3300042590 Ga0466690_098343 Ga0466690_098343_12439_14301 620
30 3300042590 Ga0466690_220752 Ga0466690_220752_11_1921 620
31 3300042596 Ga0466696_069715 Ga0466696_069715_34360_36264 620
32 3300042621 Ga0466729_051541 Ga0466729_051541_423_2327 620
33 3300042648 Ga0466709_168950 Ga0466709_168950_47829_49691 620
34 3300042601 Ga0466707_134560 Ga0466707_134560_1655_3520 621
35 3300042615 Ga0466711_402231 Ga0466711_402231_2655_4520 621
36 3300042621 Ga0466729_057120 Ga0466729_057120_258_2123 621
37 3300042624 Ga0466735_102258 Ga0466735_102258_7925_9790 621
38 3300042648 Ga0466709_100328 Ga0466709_100328_225_2132 625
39 3300042591 Ga0466692_051712 Ga0466692_051712_2224_4128 626
40 3300042648 Ga0466709_267137 Ga0466709_267137_103835_105751 626
41 iso_pr_bacteria 2820781750 2820782675 626
42 3300009826 Ga0123355_10004570 Ga0123355_100045704 628
43 iso_pr_bacteria 2590828803 2592928669 628
44 3300012837 Ga0160455_100038 Ga0160455_100038208 629
45 3300042643 Ga0466704_032962 Ga0466704_032962_35968_37875 630
46 3300042602 Ga0466713_109148 Ga0466713_109148_82_1977 631
47 3300042608 Ga0466721_150892 Ga0466721_150892_9418_11313 631
48 2225789004 2227474637 2227925261 632
49 3300042605 Ga0466716_324965 Ga0466716_324965_2195_4093 632
50 3300042652 Ga0466708_106047 Ga0466708_106047_448_2346 632
51 3300042659 Ga0466733_165495 Ga0466733_165495_13915_15813 632
52 iso_pr_bacteria 2820772500 2820772575 632
53 2225789004 2227275225 2227725696 633
54 3300000062 IMNBL1DRAFT_c0007408 IMNBL1DRAFT_00074083 633
55 3300000062 IMNBL1DRAFT_c0013817 IMNBL1DRAFT_00138172 633
56 3300007095 Ga0102739_1000052 Ga0102739_100005229 633
57 3300010049 Ga0123356_10028754 Ga0123356_100287542 633
58 3300010167 Ga0123353_10161174 Ga0123353_101611742 633
59 3300042590 Ga0466690_263875 Ga0466690_263875_2106_4007 633
60 3300042593 Ga0466691_179090 Ga0466691_179090_4329_6230 633
61 3300042609 Ga0466722_124683 Ga0466722_124683_2361_4262 633
62 3300042618 Ga0466723_253378 Ga0466723_253378_3684_5585 633
63 3300042619 Ga0466726_002951 Ga0466726_002951_54_1955 633
64 iso_pr_bacteria 2920168565 2920170848 633
65 3300042590 Ga0466690_250033 Ga0466690_250033_5135_7039 634
66 3300042590 Ga0466690_346489 Ga0466690_346489_6246_8150 634
67 3300042593 Ga0466691_028750 Ga0466691_028750_2535_4439 634
68 3300042593 Ga0466691_088235 Ga0466691_088235_288_2192 634
69 3300042596 Ga0466696_022759 Ga0466696_022759_7351_9255 634
70 3300042605 Ga0466716_039770 Ga0466716_039770_2702_4606 634
71 3300042605 Ga0466716_152236 Ga0466716_152236_279_2183 634
72 3300042606 Ga0466719_342847 Ga0466719_342847_1865_3769 634
73 3300042612 Ga0466705_399901 Ga0466705_399901_13643_15547 634
74 3300042615 Ga0466711_027006 Ga0466711_027006_22660_24564 634
75 3300042615 Ga0466711_060441 Ga0466711_060441_467_2371 634
76 3300042615 Ga0466711_165561 Ga0466711_165561_51_1955 634
77 3300042615 Ga0466711_389055 Ga0466711_389055_1700_3604 634
78 3300042616 Ga0466715_014882 Ga0466715_014882_15800_17704 634
79 3300042616 Ga0466715_352693 Ga0466715_352693_527_2431 634
80 3300042616 Ga0466715_354554 Ga0466715_354554_4416_6320 634
81 3300042618 Ga0466723_042859 Ga0466723_042859_6792_8696 634
82 3300042618 Ga0466723_110924 Ga0466723_110924_2263_4167 634
83 3300042618 Ga0466723_202456 Ga0466723_202456_1810_3714 634
84 3300042619 Ga0466726_170372 Ga0466726_170372_3128_5032 634
85 3300042620 Ga0466728_011149 Ga0466728_011149_2772_4676 634
86 3300042636 Ga0466703_098112 Ga0466703_098112_245_2149 634
87 3300042636 Ga0466703_139806 Ga0466703_139806_429_2333 634
88 3300042652 Ga0466708_395512 Ga0466708_395512_4180_6084 634
89 3300042655 Ga0466727_094701 Ga0466727_094701_2470_4374 634
90 iso_pr_bacteria 2820736622 2820737438 634
91 iso_pr_bacteria 2820740053 2820741021 634
92 iso_pr_bacteria 2820748953 2820750035 634
93 3300000062 IMNBL1DRAFT_c0011803 IMNBL1DRAFT_00118033 635
94 3300002462 JGI24702J35022_10002908 JGI24702J35022_100029088 635
95 3300002504 JGI24705J35276_12237700 JGI24705J35276_122377009 635
96 3300010167 Ga0123353_10004979 Ga0123353_100049793 635
97 3300042590 Ga0466690_003395 Ga0466690_003395_233_2140 635
98 3300042590 Ga0466690_291135 Ga0466690_291135_9779_11686 635
99 3300042596 Ga0466696_203246 Ga0466696_203246_4382_6289 635
100 3300042606 Ga0466719_048134 Ga0466719_048134_3578_5485 635
101 3300042616 Ga0466715_004531 Ga0466715_004531_2983_4890 635
102 3300042616 Ga0466715_065073 Ga0466715_065073_257_2164 635
103 3300042616 Ga0466715_067917 Ga0466715_067917_32986_34893 635
104 3300042636 Ga0466703_008449 Ga0466703_008449_745_2652 635
105 3300042636 Ga0466703_018269 Ga0466703_018269_848_2755 635
106 3300042636 Ga0466703_181739 Ga0466703_181739_241_2148 635
107 3300042636 Ga0466703_374395 Ga0466703_374395_1691_3598 635
108 3300042652 Ga0466708_121875 Ga0466708_121875_3655_5562 635
109 3300042593 Ga0466691_166354 Ga0466691_166354_11238_13148 636
110 3300042596 Ga0466696_089656 Ga0466696_089656_2682_4592 636
111 3300042605 Ga0466716_302692 Ga0466716_302692_399_2309 636
112 3300042612 Ga0466705_453075 Ga0466705_453075_391_2301 636
113 3300042618 Ga0466723_048609 Ga0466723_048609_15006_16916 636
114 3300042620 Ga0466728_062337 Ga0466728_062337_19261_21171 636
115 3300042620 Ga0466728_145377 Ga0466728_145377_2054_3964 636
116 3300042636 Ga0466703_200042 Ga0466703_200042_1979_3889 636
117 3300042636 Ga0466703_287183 Ga0466703_287183_109_2019 636
118 3300042643 Ga0466704_357207 Ga0466704_357207_280_2190 636
119 3300042659 Ga0466733_041516 Ga0466733_041516_1184_3094 636
120 3300000062 IMNBL1DRAFT_c0000270 IMNBL1DRAFT_000027036 637
121 3300042612 Ga0466705_179271 Ga0466705_179271_8815_10728 637
122 3300042618 Ga0466723_350295 Ga0466723_350295_6978_8891 637
123 3300042643 Ga0466704_127187 Ga0466704_127187_989_2902 637
124 3300042652 Ga0466708_187729 Ga0466708_187729_20579_22492 637
125 3300007140 Ga0102740_1000263 Ga0102740_10002637 638
126 3300042590 Ga0466690_332832 Ga0466690_332832_3267_5183 638
127 3300042602 Ga0466713_099770 Ga0466713_099770_2431_4347 638
128 3300042606 Ga0466719_196600 Ga0466719_196600_882_2798 638
129 3300042618 Ga0466723_034385 Ga0466723_034385_21336_23252 638
130 3300005201 Ga0072941_1022368 Ga0072941_10223683 641
131 3300042609 Ga0466722_125322 Ga0466722_125322_4886_6811 641
132 3300042599 Ga0466706_218545 Ga0466706_218545_32538_34466 642
133 3300042612 Ga0466705_470164 Ga0466705_470164_2316_4244 642
134 3300042636 Ga0466703_096460 Ga0466703_096460_7230_9158 642
135 3300042621 Ga0466729_278721 Ga0466729_278721_1987_3918 643
136 3300042596 Ga0466696_343675 Ga0466696_343675_2342_4279 645
137 iso_pr_bacteria 2820767225 2820768497 645
138 3300002931 CVPL010W_10012881 CVPL010W_100128813 652
139 3300042602 Ga0466713_010077 Ga0466713_010077_9611_11584 657
140 3300042609 Ga0466722_182126 Ga0466722_182126_4793_6775 660
141 3300042618 Ga0466723_306490 Ga0466723_306490_2663_4684 673

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00271 Helicase_C Helicase conserved C-terminal domain 255 357 0.89
PF00270 DEAD DEAD/DEAH box helicase 57 218 0.87
PF16124 RecQ_Zn_bind RecQ zinc-binding 557 603 0.86

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.79 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.