Protein Family IF08157

Metagenome Isolate
108 Members
33 Samples
107 Scaffolds
236.91 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_306310|Ga0466723_306310_47_973
Length
268 aa
Sequence
MADNTTGNTPDRALAGQAKGDPGSRAGAVPQDGDARKIIIQTKGLRKSYNTGAGAFEVLHGVDFTLREGEFASIMGPSGSGKSTFMNILGCLDTPTSGVYELLGENVAHLGGDQLASRRNIYLGFVFQGFNLLPKSDLLENVALPLLYARVPAAERLERARDLIDKVGLTKWAHHLPAQVSGGQQQRAAIARALVGRPSLVLADEPTGNLDSQTSDDIMRLFGKLNDDGLSLILVTHEPDVGDCAKRMVRFRDGQLVDDGPVQERRRP

📊 Sample Types

Isolate 0.9%
Metagenome 99.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 41.9%
Termitidae 25.8%
Rhinotermitidae 9.7%
Termopsidae 9.7%
Unclassified 6.5%
Armadillidiidae 3.2%
Hodotermitidae 3.2%

🌳 Taxonomy

Archaea 0
Bacteria 101
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
5 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
8 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
9 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
10 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
11 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
12 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
13 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
14 2820005795 Unclassified Synergistetes Nt197P3bin106 Isolate Unclassified
15 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
16 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
19 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
20 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
21 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
22 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
23 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
26 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
27 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
28 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
29 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
30 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
31 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
32 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
33 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_290711 3300042612 Bacteria 51058
2 Ga0466706_178835 3300042599 Bacteria 7774
3 Ga0466691_097092 3300042593 Bacteria 4064
4 Ga0466691_097503 3300042593 Bacteria 28441
5 Ga0466696_197267 3300042596 Bacteria 8678
6 Ga0466703_289737 3300042636 Bacteria 4528
7 Ga0466704_566657 3300042643 Bacteria 2088
8 Ga0466711_110614 3300042615 Bacteria 19692
9 Ga0466715_164257 3300042616 Bacteria 5699
10 Ga0466723_040189 3300042618 Bacteria 8929
11 Ga0466705_176265 3300042612 Bacteria 83407
12 Ga0466717_215995 3300042604 Bacteria 1883
13 Ga0466716_337707 3300042605 Bacteria 1525
14 JGI24702J35022_10021676 3300002462 Bacteria 3482
15 Ga0160430_106066 3300012852 Bacteria 2648
16 Ga0466657_019626 3300042582 Bacteria 1362
17 Ga0466692_167406 3300042591 Bacteria 107532
18 Ga0466704_099729 3300042643 Bacteria 4492
19 Ga0466708_240012 3300042652 Unclassified 2388
20 Ga0466711_195169 3300042615 Bacteria 6567
21 Ga0466715_067015 3300042616 Bacteria 8539
22 Ga0466715_170614 3300042616 Bacteria 52118
23 Ga0466715_497338 3300042616 Bacteria 7446
24 Ga0466723_080378 3300042618 Bacteria 2739
25 Ga0466726_031107 3300042619 Bacteria 7260
26 Ga0466705_080415 3300042612 Bacteria 10433
27 Ga0466705_101917 3300042612 Bacteria 18782
28 Ga0466705_365806 3300042612 Bacteria 24060
29 Ga0123356_10277420 3300010049 Bacteria 1769
30 Ga0123353_10163705 3300010167 Bacteria 3538
31 Ga0466716_399302 3300042605 Bacteria 1164
32 Ga0466719_455954 3300042606 Bacteria 14901
33 Ga0160452_111197 3300012834 Bacteria 1077
34 Ga0466657_319936 3300042582 Bacteria 8748
35 Ga0466729_271107 3300042621 Bacteria 47199
36 Ga0466729_279111 3300042621 Bacteria 8241
37 Ga0466703_057586 3300042636 Bacteria 2374
38 Ga0466703_180386 3300042636 Bacteria 14016
39 Ga0466704_345075 3300042643 Bacteria 4921
40 Ga0466708_083410 3300042652 Bacteria 1759
41 Ga0466708_283700 3300042652 Bacteria 4748
42 Ga0466712_014136 3300042614 Bacteria 13538
43 Ga0466711_151558 3300042615 Bacteria 2137
44 Ga0466715_606490 3300042616 Bacteria 27172
45 Ga0466715_623989 3300042616 Bacteria 2019
46 Ga0466723_050630 3300042618 Bacteria 12095
47 Ga0466723_272681 3300042618 Bacteria 22667
48 Ga0466705_042395 3300042612 Bacteria 16216
49 Ga0466706_086190 3300042599 Bacteria 6287
50 Ga0466719_289075 3300042606 Unclassified 2306
51 Ga0466657_256288 3300042582 Bacteria 5117
52 Ga0466691_056404 3300042593 Bacteria 11936
53 Ga0466691_193704 3300042593 Unclassified 15437
54 Ga0466708_085444 3300042652 Bacteria 2480
55 Ga0466725_020549 3300042654 Bacteria 17902
56 Ga0466725_193092 3300042654 Bacteria 188399
57 Ga0466715_471712 3300042616 Bacteria 11959
58 Ga0466723_306310 3300042618 Bacteria 3102
59 Ga0466723_325831 3300042618 Bacteria 14355
60 Ga0466705_007581 3300042612 Bacteria 19716
61 Ga0466699_256950 3300042597 Bacteria 1795
62 Ga0466703_415999 3300042636 Bacteria 22737
63 Ga0466704_400122 3300042643 Bacteria 6035
64 Ga0466726_354511 3300042619 Bacteria 11240
65 Ga0123356_10030647 3300010049 Bacteria 5034
66 Ga0123353_10268774 3300010167 Bacteria 2629
67 Ga0466707_009582 3300042601 Bacteria 2504
68 Ga0466707_148461 3300042601 Bacteria 2767
69 Ga0466722_067351 3300042609 Bacteria 51487
70 Ga0466722_081413 3300042609 Bacteria 3136
71 Ga0466696_379893 3300042596 Bacteria 11799
72 Ga0466703_284308 3300042636 Bacteria 1643
73 Ga0466703_313745 3300042636 Bacteria 3426
74 Ga0466703_421491 3300042636 Bacteria 3498
75 Ga0466708_406078 3300042652 Unclassified 6474
76 Ga0466705_404991 3300042612 Unclassified 9273
77 Ga0466715_110004 3300042616 Bacteria 55498
78 Ga0466726_112532 3300042619 Bacteria 14275
79 Ga0466726_300186 3300042619 Bacteria 1934
80 Ga0466705_183211 3300042612 Bacteria 25916
81 Ga0466719_188242 3300042606 Unclassified 1030
82 Ga0466691_162188 3300042593 Bacteria 6554
83 Ga0466709_319140 3300042648 Bacteria 1215
84 Ga0466708_009549 3300042652 Bacteria 40988
85 Ga0466708_402993 3300042652 Bacteria 4878
86 Ga0466725_181011 3300042654 Bacteria 7881
87 Ga0466705_478505 3300042612 Bacteria 5271
88 Ga0466711_262384 3300042615 Bacteria 9672
89 Ga0466715_634401 3300042616 Bacteria 2127
90 Ga0466728_034351 3300042620 Bacteria 4011
91 Ga0466707_187336 3300042601 Bacteria 4111
92 Ga0466707_206652 3300042601 Bacteria 4410
93 Ga0466719_230276 3300042606 Bacteria 6810
94 Ga0160443_100001 3300012848 Bacteria 1289775
95 Ga0466691_048975 3300042593 Unclassified 1213
96 Ga0466696_118002 3300042596 Bacteria 35989
97 Ga0466729_267785 3300042621 Bacteria 1886
98 Ga0466735_007437 3300042624 Bacteria 1363
99 Ga0466704_442667 3300042643 Bacteria 2556
100 Ga0466709_000925 3300042648 Bacteria 6222
101 Ga0466708_070375 3300042652 Bacteria 36593
102 Ga0466708_231198 3300042652 Bacteria 82349
103 Ga0466708_424940 3300042652 Bacteria 5157
104 Ga0466727_172651 3300042655 Bacteria 13036
105 Ga0466723_288467 3300042618 Bacteria 3073
106 Ga0466728_039494 3300042620 Bacteria 1156
107 Ga0466728_260711 3300042620 Bacteria 9959

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042582 Ga0466657_256288 Ga0466657_256288_4333_5031 219
2 3300042609 Ga0466722_067351 Ga0466722_067351_21973_22635 220
3 3300042621 Ga0466729_279111 Ga0466729_279111_3155_3817 220
4 3300042636 Ga0466703_057586 Ga0466703_057586_345_1016 223
5 3300042616 Ga0466715_110004 Ga0466715_110004_41027_41704 225
6 3300042618 Ga0466723_080378 Ga0466723_080378_1544_2323 225
7 3300042615 Ga0466711_110614 Ga0466711_110614_18479_19159 226
8 3300012852 Ga0160430_106066 Ga0160430_1060662 228
9 3300042612 Ga0466705_365806 Ga0466705_365806_14182_14877 231
10 3300042618 Ga0466723_325831 Ga0466723_325831_2209_2904 231
11 3300042619 Ga0466726_354511 Ga0466726_354511_7728_8423 231
12 3300042612 Ga0466705_007581 Ga0466705_007581_9022_9720 232
13 3300042615 Ga0466711_151558 Ga0466711_151558_567_1265 232
14 3300010049 Ga0123356_10030647 Ga0123356_100306475 233
15 3300042593 Ga0466691_056404 Ga0466691_056404_2867_3568 233
16 3300042596 Ga0466696_379893 Ga0466696_379893_3677_4378 233
17 3300042606 Ga0466719_188242 Ga0466719_188242_262_963 233
18 3300042606 Ga0466719_289075 Ga0466719_289075_46_747 233
19 3300042612 Ga0466705_042395 Ga0466705_042395_2402_3103 233
20 3300042616 Ga0466715_170614 Ga0466715_170614_18011_18712 233
21 3300042616 Ga0466715_606490 Ga0466715_606490_15747_16448 233
22 3300042618 Ga0466723_272681 Ga0466723_272681_2447_3148 233
23 3300042636 Ga0466703_289737 Ga0466703_289737_3434_4135 233
24 3300042636 Ga0466703_421491 Ga0466703_421491_387_1088 233
25 3300042652 Ga0466708_085444 Ga0466708_085444_1187_1888 233
26 3300042652 Ga0466708_240012 Ga0466708_240012_1404_2105 233
27 3300042593 Ga0466691_048975 Ga0466691_048975_481_1185 234
28 3300042593 Ga0466691_193704 Ga0466691_193704_209_913 234
29 3300042596 Ga0466696_197267 Ga0466696_197267_3805_4509 234
30 3300042601 Ga0466707_009582 Ga0466707_009582_516_1220 234
31 3300042605 Ga0466716_337707 Ga0466716_337707_24_728 234
32 3300042606 Ga0466719_230276 Ga0466719_230276_4863_5600 234
33 3300042612 Ga0466705_101917 Ga0466705_101917_13673_14377 234
34 3300042612 Ga0466705_183211 Ga0466705_183211_17989_18693 234
35 3300042612 Ga0466705_478505 Ga0466705_478505_1292_1996 234
36 3300042616 Ga0466715_067015 Ga0466715_067015_71_775 234
37 3300042616 Ga0466715_497338 Ga0466715_497338_565_1269 234
38 3300042616 Ga0466715_623989 Ga0466715_623989_91_795 234
39 3300042619 Ga0466726_112532 Ga0466726_112532_8211_8915 234
40 3300042620 Ga0466728_039494 Ga0466728_039494_144_848 234
41 3300042620 Ga0466728_260711 Ga0466728_260711_2095_2799 234
42 3300042636 Ga0466703_284308 Ga0466703_284308_396_1100 234
43 3300042643 Ga0466704_345075 Ga0466704_345075_2425_3129 234
44 3300042643 Ga0466704_400122 Ga0466704_400122_2922_3626 234
45 3300042648 Ga0466709_000925 Ga0466709_000925_714_1418 234
46 3300042652 Ga0466708_083410 Ga0466708_083410_939_1643 234
47 3300042652 Ga0466708_283700 Ga0466708_283700_441_1145 234
48 3300042593 Ga0466691_097503 Ga0466691_097503_14282_14989 235
49 3300042596 Ga0466696_118002 Ga0466696_118002_20621_21328 235
50 3300042612 Ga0466705_176265 Ga0466705_176265_25764_26471 235
51 3300042612 Ga0466705_290711 Ga0466705_290711_45361_46068 235
52 3300042612 Ga0466705_404991 Ga0466705_404991_675_1382 235
53 3300042615 Ga0466711_262384 Ga0466711_262384_6467_7174 235
54 3300042636 Ga0466703_313745 Ga0466703_313745_1015_1722 235
55 3300042648 Ga0466709_319140 Ga0466709_319140_413_1120 235
56 3300042652 Ga0466708_402993 Ga0466708_402993_1274_1981 235
57 3300042652 Ga0466708_406078 Ga0466708_406078_1274_1981 235
58 3300042654 Ga0466725_181011 Ga0466725_181011_1713_2420 235
59 3300010167 Ga0123353_10268774 Ga0123353_102687742 236
60 3300042593 Ga0466691_097092 Ga0466691_097092_1436_2146 236
61 3300042593 Ga0466691_162188 Ga0466691_162188_1869_2606 236
62 3300042604 Ga0466717_215995 Ga0466717_215995_407_1117 236
63 3300042605 Ga0466716_399302 Ga0466716_399302_55_765 236
64 3300042612 Ga0466705_080415 Ga0466705_080415_366_1076 236
65 3300042615 Ga0466711_195169 Ga0466711_195169_2292_3002 236
66 3300042616 Ga0466715_164257 Ga0466715_164257_2605_3315 236
67 3300042618 Ga0466723_288467 Ga0466723_288467_2102_2812 236
68 3300042636 Ga0466703_415999 Ga0466703_415999_21065_21775 236
69 3300042643 Ga0466704_099729 Ga0466704_099729_2387_3097 236
70 3300042643 Ga0466704_566657 Ga0466704_566657_422_1132 236
71 3300042652 Ga0466708_009549 Ga0466708_009549_5807_6517 236
72 iso_pr_bacteria 2820005795 2820005946 236
73 3300002462 JGI24702J35022_10021676 JGI24702J35022_100216763 237
74 3300010167 Ga0123353_10163705 Ga0123353_101637052 237
75 3300042619 Ga0466726_031107 Ga0466726_031107_1587_2300 237
76 3300042619 Ga0466726_300186 Ga0466726_300186_329_1042 237
77 3300042652 Ga0466708_424940 Ga0466708_424940_2711_3424 237
78 3300042618 Ga0466723_040189 Ga0466723_040189_1916_2632 238
79 3300042624 Ga0466735_007437 Ga0466735_007437_563_1279 238
80 3300042643 Ga0466704_442667 Ga0466704_442667_147_863 238
81 3300012834 Ga0160452_111197 Ga0160452_1111972 239
82 3300042616 Ga0466715_634401 Ga0466715_634401_687_1406 239
83 3300042582 Ga0466657_019626 Ga0466657_019626_478_1200 240
84 3300042582 Ga0466657_319936 Ga0466657_319936_7235_7957 240
85 3300042654 Ga0466725_193092 Ga0466725_193092_176800_177522 240
86 3300042591 Ga0466692_167406 Ga0466692_167406_15179_15904 241
87 3300042601 Ga0466707_206652 Ga0466707_206652_1907_2632 241
88 3300042614 Ga0466712_014136 Ga0466712_014136_1000_1725 241
89 3300042609 Ga0466722_081413 Ga0466722_081413_2136_2864 242
90 3300042616 Ga0466715_471712 Ga0466715_471712_1764_2492 242
91 3300042654 Ga0466725_020549 Ga0466725_020549_5760_6488 242
92 3300042597 Ga0466699_256950 Ga0466699_256950_247_981 244
93 3300042620 Ga0466728_034351 Ga0466728_034351_2725_3480 244
94 3300010049 Ga0123356_10277420 Ga0123356_102774202 245
95 3300042601 Ga0466707_187336 Ga0466707_187336_1103_1843 246
96 3300042621 Ga0466729_271107 Ga0466729_271107_43902_44642 246
97 3300042655 Ga0466727_172651 Ga0466727_172651_2679_3419 246
98 3300042606 Ga0466719_455954 Ga0466719_455954_10055_10798 247
99 3300042636 Ga0466703_180386 Ga0466703_180386_6031_6774 247
100 3300042599 Ga0466706_178835 Ga0466706_178835_1281_2033 250
101 3300042652 Ga0466708_070375 Ga0466708_070375_21745_22497 250
102 3300012848 Ga0160443_100001 Ga0160443_100001782 252
103 3300042601 Ga0466707_148461 Ga0466707_148461_1762_2520 252
104 3300042599 Ga0466706_086190 Ga0466706_086190_4278_5174 254
105 3300042618 Ga0466723_050630 Ga0466723_050630_3115_3879 254
106 3300042621 Ga0466729_267785 Ga0466729_267785_985_1752 255
107 3300042652 Ga0466708_231198 Ga0466708_231198_79562_80407 265
108 3300042618 Ga0466723_306310 Ga0466723_306310_47_973 268

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 59 207 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.