Protein Family IF08146

Metagenome Isolate
119 Members
38 Samples
114 Scaffolds
352.55 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_278216|Ga0466723_278216_3483_4664
Length
393 aa
Sequence
LPENFLEKKEAPQELSKVFLIKFLLEALGKKFMTWILRTLAVLFIFLAPLSCSSQDSNNPQTSSKNSEITVIFIPKITGNAFFEAASVGAKEYASRHGFQVDYQGYPEADVSKQIEIIERAIANKATAISVSSLDAKALDPVLMKALKAGIKVTTWDSDVSGNARLIMISQGTPSQLGKMLVEMAVKSLDKRGKNPASDPIRYAWHYSQASVADQNSWRVAGEEYIHDVYPNWINVNPENFYSMQDPARALSVGKEIISAHPDIDVIICNDSTSLPGQAQALQELGLGANDVTVTGFSPPNAMREYAKAGIIDRWGLWDCQIQGALACYIAYYLASGNQLNVGQMVDVPEIGLIEVMPNTVLDPGAYTAPNSGVVLLPRRTEFTAENVDDYNF

📊 Sample Types

Isolate 4.2%
Metagenome 95.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 36.8%
Termitidae 28.9%
Unclassified 18.4%
Rhinotermitidae 7.9%
Termopsidae 5.3%
Hodotermitidae 2.6%

🌳 Taxonomy

Archaea 0
Bacteria 112
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
2 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
11 650716102 Treponema primitia ZAS-2 Isolate Unclassified
12 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
13 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
16 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
17 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
18 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
19 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
20 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
21 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
22 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
23 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
24 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
25 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
26 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
27 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
28 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
29 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
30 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
31 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
32 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
33 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
34 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
35 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
36 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
37 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
38 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_214068 3300042612 Bacteria 3497
2 JGI24695J34938_10037685 3300002450 Bacteria 2195
3 Ga0466690_117737 3300042590 Bacteria 3211
4 Ga0466691_082353 3300042593 Bacteria 10592
5 Ga0466691_162741 3300042593 Bacteria 25322
6 Ga0466706_115144 3300042599 Bacteria 2597
7 Ga0466713_039544 3300042602 Bacteria 3663
8 Ga0466705_412283 3300042612 Bacteria 1844
9 Ga0466711_458388 3300042615 Bacteria 4742
10 Ga0466715_246965 3300042616 Bacteria 4367
11 Ga0466723_306094 3300042618 Bacteria 2616
12 Ga0466726_421544 3300042619 Bacteria 2417
13 Ga0466729_259264 3300042621 Bacteria 1819
14 Ga0466735_157925 3300042624 Bacteria 2870
15 Ga0466703_037504 3300042636 Unclassified 2072
16 Ga0466703_060122 3300042636 Bacteria 3815
17 Ga0466709_088864 3300042648 Bacteria 2007
18 Ga0466709_378036 3300042648 Bacteria 6168
19 Ga0466708_030544 3300042652 Bacteria 1335
20 Ga0466708_391997 3300042652 Bacteria 3099
21 Ga0466705_126427 3300042612 Bacteria 20907
22 Ga0072940_1006750 3300005200 Unclassified 5465
23 Ga0466691_217383 3300042593 Bacteria 8251
24 Ga0466707_156209 3300042601 Bacteria 1688
25 Ga0466712_180841 3300042614 Bacteria 2069
26 Ga0466711_028236 3300042615 Bacteria 8690
27 Ga0466711_241365 3300042615 Bacteria 14389
28 Ga0466715_268147 3300042616 Bacteria 9723
29 Ga0466723_047750 3300042618 Bacteria 8066
30 Ga0466723_278216 3300042618 Bacteria 6800
31 Ga0466728_222528 3300042620 Bacteria 13303
32 Ga0466729_217107 3300042621 Bacteria 2119
33 Ga0466704_263668 3300042643 Unclassified 8948
34 Ga0466693_186663 3300042592 Bacteria 8955
35 Ga0466691_133708 3300042593 Bacteria 23029
36 Ga0466691_187892 3300042593 Bacteria 2414
37 Ga0466707_413381 3300042601 Bacteria 2051
38 Ga0466713_094003 3300042602 Bacteria 21513
39 Ga0466717_151008 3300042604 Bacteria 16555
40 Ga0466719_293885 3300042606 Bacteria 7388
41 Ga0466703_013427 3300042636 Bacteria 5595
42 Ga0466692_136704 3300042591 Bacteria 4420
43 Ga0466716_277485 3300042605 Bacteria 6940
44 Ga0466722_117569 3300042609 Bacteria 36546
45 Ga0466722_253580 3300042609 Bacteria 4274
46 Ga0466711_249608 3300042615 Bacteria 11268
47 Ga0466715_056935 3300042616 Bacteria 2962
48 Ga0466715_104840 3300042616 Bacteria 52795
49 Ga0466715_124791 3300042616 Bacteria 5765
50 Ga0466715_174171 3300042616 Bacteria 4924
51 Ga0466715_237490 3300042616 Bacteria 8390
52 Ga0466723_041583 3300042618 Bacteria 3735
53 Ga0466723_219907 3300042618 Bacteria 1858
54 Ga0466723_222863 3300042618 Bacteria 36841
55 Ga0466723_298179 3300042618 Bacteria 12304
56 Ga0466728_042173 3300042620 Bacteria 1399
57 Ga0466703_237663 3300042636 Bacteria 27703
58 Ga0466690_053199 3300042590 Bacteria 4367
59 Ga0466690_062952 3300042590 Bacteria 6987
60 Ga0466691_070720 3300042593 Bacteria 8035
61 Ga0466719_261154 3300042606 Bacteria 11097
62 Ga0466705_495859 3300042612 Bacteria 8033
63 Ga0466715_254529 3300042616 Bacteria 7300
64 Ga0466715_420395 3300042616 Bacteria 5308
65 Ga0466723_014744 3300042618 Bacteria 29092
66 Ga0466723_076653 3300042618 Bacteria 13881
67 Ga0466704_042914 3300042643 Bacteria 7219
68 Ga0466709_143484 3300042648 Bacteria 162355
69 AustNasuHG_c1000319 3300000089 Bacteria 16758
70 Ga0466690_008210 3300042590 Bacteria 3966
71 Ga0466691_041099 3300042593 Bacteria 14815
72 Ga0466696_167001 3300042596 Unclassified 1450
73 Ga0466732_188806 3300042656 Bacteria 1578
74 Ga0466705_455225 3300042612 Bacteria 3774
75 Ga0466715_151694 3300042616 Bacteria 5706
76 Ga0466718_145948 3300042617 Bacteria 5798
77 Ga0466723_099969 3300042618 Bacteria 53553
78 Ga0466728_010251 3300042620 Bacteria 21388
79 Ga0466735_015230 3300042624 Bacteria 13305
80 Ga0466703_071094 3300042636 Bacteria 12043
81 Ga0466709_188758 3300042648 Bacteria 4614
82 Ga0415639_083977 3300038395 Unclassified 4628
83 Ga0466690_289029 3300042590 Bacteria 1769
84 Ga0466692_003835 3300042591 Bacteria 1716
85 Ga0466696_204756 3300042596 Bacteria 10800
86 Ga0466732_399151 3300042656 Bacteria 7107
87 Ga0466713_151633 3300042602 Bacteria 10085
88 Ga0466722_160345 3300042609 Bacteria 1419
89 Ga0466722_168877 3300042609 Bacteria 5358
90 Ga0466705_484358 3300042612 Bacteria 2491
91 Ga0466711_091961 3300042615 Bacteria 2974
92 Ga0466723_241174 3300042618 Bacteria 4535
93 Ga0466723_275199 3300042618 Unclassified 7464
94 Ga0123353_10097506 3300010167 Bacteria 4738
95 Ga0466735_223510 3300042624 Bacteria 3576
96 Ga0466704_136420 3300042643 Bacteria 13703
97 Ga0466708_040294 3300042652 Bacteria 5869
98 Ga0466705_245023 3300042612 Bacteria 21288
99 Ga0466690_103893 3300042590 Bacteria 3641
100 Ga0466695_106144 3300042595 Bacteria 1556
101 Ga0466707_398475 3300042601 Bacteria 1082
102 Ga0466716_086539 3300042605 Bacteria 3248
103 Ga0466719_085807 3300042606 Bacteria 4691
104 Ga0466719_412222 3300042606 Bacteria 1315
105 Ga0466711_347466 3300042615 Bacteria 7122
106 Ga0466715_016537 3300042616 Bacteria 14222
107 Ga0466715_387404 3300042616 Bacteria 5122
108 Ga0466726_349239 3300042619 Bacteria 1443
109 Ga0466726_353624 3300042619 Bacteria 4352
110 Ga0466729_261430 3300042621 Bacteria 26177
111 Ga0466735_140941 3300042624 Bacteria 3200
112 Ga0466703_231435 3300042636 Bacteria 27613
113 Ga0466704_007510 3300042643 Unclassified 7159
114 Ga0466708_153088 3300042652 Bacteria 21028

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042636 Ga0466703_037504 Ga0466703_037504_80_1033 317
2 3300042618 Ga0466723_275199 Ga0466723_275199_2237_3196 319
3 3300042636 Ga0466703_060122 Ga0466703_060122_1447_2535 320
4 3300042601 Ga0466707_398475 Ga0466707_398475_67_1035 322
5 3300042612 Ga0466705_455225 Ga0466705_455225_2215_3183 322
6 3300042604 Ga0466717_151008 Ga0466717_151008_10251_11222 323
7 3300042605 Ga0466716_086539 Ga0466716_086539_1736_2707 323
8 3300042612 Ga0466705_484358 Ga0466705_484358_361_1338 325
9 3300042617 Ga0466718_145948 Ga0466718_145948_42_1118 325
10 3300042592 Ga0466693_186663 Ga0466693_186663_3012_4085 326
11 3300042596 Ga0466696_167001 Ga0466696_167001_291_1361 327
12 3300042616 Ga0466715_268147 Ga0466715_268147_6597_7670 329
13 3300042593 Ga0466691_041099 Ga0466691_041099_2928_4001 330
14 3300042593 Ga0466691_217383 Ga0466691_217383_6698_7690 330
15 3300042593 Ga0466691_187892 Ga0466691_187892_763_1839 331
16 3300042616 Ga0466715_174171 Ga0466715_174171_3316_4389 331
17 3300042652 Ga0466708_030544 Ga0466708_030544_214_1290 331
18 3300042618 Ga0466723_306094 Ga0466723_306094_1007_2098 335
19 3300042612 Ga0466705_214068 Ga0466705_214068_1608_2696 336
20 3300042616 Ga0466715_104840 Ga0466715_104840_50118_51137 339
21 3300042616 Ga0466715_237490 Ga0466715_237490_4809_5885 339
22 3300042643 Ga0466704_136420 Ga0466704_136420_465_1556 339
23 3300002450 JGI24695J34938_10037685 JGI24695J34938_100376852 340
24 3300042618 Ga0466723_041583 Ga0466723_041583_814_1905 340
25 3300042614 Ga0466712_180841 Ga0466712_180841_522_1589 341
26 3300042620 Ga0466728_042173 Ga0466728_042173_15_1091 342
27 3300042619 Ga0466726_349239 Ga0466726_349239_55_1086 343
28 3300042636 Ga0466703_231435 Ga0466703_231435_6837_7868 343
29 3300042616 Ga0466715_151694 Ga0466715_151694_2441_3475 344
30 3300042601 Ga0466707_413381 Ga0466707_413381_828_1904 345
31 3300042616 Ga0466715_387404 Ga0466715_387404_2107_3144 345
32 3300042612 Ga0466705_245023 Ga0466705_245023_3352_4392 346
33 3300042615 Ga0466711_241365 Ga0466711_241365_10656_11735 347
34 3300042643 Ga0466704_263668 Ga0466704_263668_4241_5329 347
35 3300010167 Ga0123353_10097506 Ga0123353_100975063 348
36 3300042590 Ga0466690_117737 Ga0466690_117737_381_1460 348
37 3300042616 Ga0466715_016537 Ga0466715_016537_1772_2821 349
38 3300042652 Ga0466708_153088 Ga0466708_153088_12486_13574 349
39 3300042618 Ga0466723_241174 Ga0466723_241174_1341_2393 350
40 3300042621 Ga0466729_261430 Ga0466729_261430_20404_21456 350
41 3300042593 Ga0466691_082353 Ga0466691_082353_8032_9087 351
42 3300042621 Ga0466729_217107 Ga0466729_217107_493_1548 351
43 3300042590 Ga0466690_289029 Ga0466690_289029_140_1240 352
44 3300042636 Ga0466703_013427 Ga0466703_013427_1713_2792 353
45 3300042648 Ga0466709_378036 Ga0466709_378036_2795_3856 353
46 iso_pr_bacteria 2820389254 2820390919 354
47 3300042609 Ga0466722_117569 Ga0466722_117569_32987_34054 355
48 3300042615 Ga0466711_028236 Ga0466711_028236_5640_6707 355
49 3300042648 Ga0466709_188758 Ga0466709_188758_2844_3947 355
50 iso_pr_bacteria 2781125632 2781272058 355
51 iso_pr_bacteria 2781125685 2781416661 355
52 3300042591 Ga0466692_003835 Ga0466692_003835_597_1688 356
53 3300042599 Ga0466706_115144 Ga0466706_115144_827_1897 356
54 3300042615 Ga0466711_091961 Ga0466711_091961_1141_2211 356
55 3300038395 Ga0415639_083977 Ga0415639_083977_719_1792 357
56 3300042606 Ga0466719_261154 Ga0466719_261154_3092_4165 357
57 3300042609 Ga0466722_168877 Ga0466722_168877_3345_4418 357
58 3300042609 Ga0466722_253580 Ga0466722_253580_1389_2462 357
59 3300042615 Ga0466711_249608 Ga0466711_249608_2626_3699 357
60 3300042615 Ga0466711_347466 Ga0466711_347466_3088_4161 357
61 3300042616 Ga0466715_246965 Ga0466715_246965_1685_2758 357
62 3300042621 Ga0466729_259264 Ga0466729_259264_412_1485 357
63 3300042636 Ga0466703_071094 Ga0466703_071094_7073_8146 357
64 3300042643 Ga0466704_007510 Ga0466704_007510_5717_6790 357
65 3300042656 Ga0466732_188806 Ga0466732_188806_205_1278 357
66 3300000089 AustNasuHG_c1000319 AustNasuHG_10003196 358
67 3300042590 Ga0466690_008210 Ga0466690_008210_893_1969 358
68 3300042595 Ga0466695_106144 Ga0466695_106144_470_1546 358
69 3300042602 Ga0466713_151633 Ga0466713_151633_7035_8111 358
70 3300042606 Ga0466719_412222 Ga0466719_412222_198_1274 358
71 3300042609 Ga0466722_160345 Ga0466722_160345_66_1142 358
72 3300042616 Ga0466715_420395 Ga0466715_420395_2258_3334 358
73 3300042618 Ga0466723_047750 Ga0466723_047750_3596_4672 358
74 3300042618 Ga0466723_298179 Ga0466723_298179_5705_6781 358
75 3300042619 Ga0466726_421544 Ga0466726_421544_1067_2143 358
76 3300042624 Ga0466735_223510 Ga0466735_223510_1115_2191 358
77 3300042656 Ga0466732_399151 Ga0466732_399151_3229_4305 358
78 3300005200 Ga0072940_1006750 Ga0072940_10067502 359
79 3300042590 Ga0466690_103893 Ga0466690_103893_922_2001 359
80 3300042602 Ga0466713_039544 Ga0466713_039544_300_1379 359
81 3300042602 Ga0466713_094003 Ga0466713_094003_6697_7776 359
82 3300042606 Ga0466719_085807 Ga0466719_085807_481_1560 359
83 3300042606 Ga0466719_293885 Ga0466719_293885_4147_5226 359
84 3300042620 Ga0466728_222528 Ga0466728_222528_3973_5052 359
85 iso_pr_bacteria 650716099 650879316 359
86 iso_pr_bacteria 650716102 650883606 359
87 3300042618 Ga0466723_099969 Ga0466723_099969_9495_10577 360
88 3300042624 Ga0466735_015230 Ga0466735_015230_4103_5185 360
89 3300042643 Ga0466704_042914 Ga0466704_042914_5075_6157 360
90 3300042648 Ga0466709_088864 Ga0466709_088864_732_1814 360
91 3300042590 Ga0466690_053199 Ga0466690_053199_1869_2954 361
92 3300042591 Ga0466692_136704 Ga0466692_136704_2028_3113 361
93 3300042593 Ga0466691_133708 Ga0466691_133708_8940_10025 361
94 3300042596 Ga0466696_204756 Ga0466696_204756_8327_9412 361
95 3300042605 Ga0466716_277485 Ga0466716_277485_3818_4903 361
96 3300042612 Ga0466705_126427 Ga0466705_126427_1389_2474 361
97 3300042620 Ga0466728_010251 Ga0466728_010251_16776_17861 361
98 3300042624 Ga0466735_140941 Ga0466735_140941_529_1614 361
99 3300042590 Ga0466690_062952 Ga0466690_062952_4587_5675 362
100 3300042618 Ga0466723_014744 Ga0466723_014744_1774_2865 363
101 3300042618 Ga0466723_076653 Ga0466723_076653_4808_5899 363
102 3300042624 Ga0466735_157925 Ga0466735_157925_546_1637 363
103 3300042612 Ga0466705_412283 Ga0466705_412283_208_1302 364
104 3300042618 Ga0466723_219907 Ga0466723_219907_617_1711 364
105 3300042636 Ga0466703_237663 Ga0466703_237663_7209_8303 364
106 3300042612 Ga0466705_495859 Ga0466705_495859_6243_7340 365
107 3300042616 Ga0466715_056935 Ga0466715_056935_1716_2840 366
108 3300042618 Ga0466723_222863 Ga0466723_222863_34687_35823 368
109 3300042601 Ga0466707_156209 Ga0466707_156209_304_1413 369
110 3300042615 Ga0466711_458388 Ga0466711_458388_2514_3623 369
111 3300042593 Ga0466691_162741 Ga0466691_162741_5178_6308 370
112 3300042616 Ga0466715_254529 Ga0466715_254529_6172_7284 370
113 3300042619 Ga0466726_353624 Ga0466726_353624_593_1705 370
114 3300042652 Ga0466708_040294 Ga0466708_040294_397_1527 376
115 3300042593 Ga0466691_070720 Ga0466691_070720_6680_7816 378
116 3300042616 Ga0466715_124791 Ga0466715_124791_4482_5618 378
117 3300042652 Ga0466708_391997 Ga0466708_391997_1132_2277 381
118 3300042648 Ga0466709_143484 Ga0466709_143484_67127_68278 383
119 3300042618 Ga0466723_278216 Ga0466723_278216_3483_4664 393

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13407 Peripla_BP_4 Periplasmic binding protein domain 72 338 0.97

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
6dsp-assembly2.cif.gz_B LsrB from Clostridium saccharobutylicum in complex with AI-2 0.992 69 393
3t95-assembly1.cif.gz_A Crystal structure of LsrB from Yersinia pestis complexed with autoinducer-2 0.975 69 393
3ejw-assembly2.cif.gz_B Crystal Structure of the Sinorhizobium meliloti AI-2 receptor, SmLsrB 0.975 68 393
4pz0-assembly1.cif.gz_A The crystal structure of a solute binding protein from Bacillus anthracis str. Ames in complex with quorum-sensing signal autoinducer-2 (AI-2) 0.972 69 393
3ksm-assembly3.cif.gz_B Crystal structure of ABC-type sugar transport system, periplasmic component from Hahella chejuensis 0.943 71 337
IDDescriptionScoreStartEndSuperfamily
6dspB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 1 171 393 3.40.50.2300
af_P76142_28_264_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.98 70 312 3.40.605.10
4pz0A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9773 171 393 3.40.50.2300
6dspB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9738 69 377 3.40.50.2300
af_P76142_29_128_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9733 71 168 3.40.50.2300
IDDescriptionScoreStartEndGO Terms
AF-C5EKT6-F1-model_v4 Uncharacterized/unreviewed 0.9947 69 393

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.