Protein Family IF08128

Metagenome Isolate
115 Members
45 Samples
103 Scaffolds
237.85 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_245046|Ga0466723_245046_21425_22156
Length
243 aa
Sequence
MNKSETLSIIIPVYNEAVTIHLILNKIHAVNLIKNINKEIIIVNDCSEDNTVEVIEHYIATHIDSNIRLFSQPVNMGKGAALRKGIELAQGDYIIIQDADLEYDPEDYNLLLKPMLTEARADVVYGSRFIGGNPHRILFFGHTIGNKLLTFFSNMFTNFNLTDMETCYKLFRANIIKNINLCENRFGFEPEVTAKIAQIKNIRIYEVGISYYGRTYLEGKKIVWKDGFRAIYCIIKYNIFKHK

📊 Sample Types

Isolate 10.4%
Metagenome 89.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 31.1%
Termitidae 20.0%
Blattidae 17.8%
Unclassified 11.1%
Termopsidae 8.9%
Rhinotermitidae 6.7%
Formicidae 2.2%
Passalidae 2.2%

🌳 Taxonomy

Archaea 1
Bacteria 108
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
2 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
3 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
6 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
7 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
8 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
9 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
10 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
13 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
14 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
15 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
16 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
17 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
18 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
19 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
20 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
21 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
22 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
27 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
28 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
29 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
30 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
31 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
32 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
33 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
34 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
35 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
36 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
37 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
38 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
39 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
40 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
41 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
42 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
43 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
44 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
45 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466730_075978 3300042625 Bacteria 3936
2 Ga0466704_527087 3300042643 Bacteria 1394
3 Ga0466711_107758 3300042615 Unclassified 3626
4 Ga0466711_319043 3300042615 Bacteria 29172
5 Ga0466729_136757 3300042621 Bacteria 29827
6 Ga0466657_323959 3300042582 Bacteria 42947
7 Ga0466692_118383 3300042591 Bacteria 21469
8 Ga0466696_477025 3300042596 Bacteria 1806
9 Ga0466707_003738 3300042601 Bacteria 6216
10 Ga0466707_091241 3300042601 Bacteria 1945
11 Ga0466713_017731 3300042602 Bacteria 33130
12 Ga0466713_101233 3300042602 Bacteria 10601
13 Ga0466713_138308 3300042602 Bacteria 2595
14 Ga0466716_134562 3300042605 Bacteria 8186
15 Ga0466698_101594 3300042610 Bacteria 1120
16 Ga0466733_055432 3300042659 Bacteria 55157
17 Ga0466733_089767 3300042659 Bacteria 58709
18 Ga0466735_103066 3300042624 Bacteria 3200
19 Ga0466703_339730 3300042636 Bacteria 24723
20 Ga0466704_063151 3300042643 Bacteria 43621
21 Ga0466708_159923 3300042652 Bacteria 9701
22 Ga0466711_211713 3300042615 Bacteria 28950
23 Ga0466715_586438 3300042616 Bacteria 86506
24 Ga0466728_064211 3300042620 Bacteria 3409
25 Ga0466716_288287 3300042605 Bacteria 6846
26 IMNBL1DRAFT_c0015266 3300000062 Bacteria 3338
27 Ga0466705_017710 3300042612 Bacteria 4047
28 Ga0466703_244452 3300042636 Unclassified 1039
29 Ga0466715_157130 3300042616 Bacteria 4185
30 Ga0466691_043986 3300042593 Bacteria 17199
31 Ga0466696_027337 3300042596 Bacteria 2485
32 Ga0466699_147792 3300042597 Bacteria 1276
33 Ga0466705_256370 3300042612 Bacteria 21200
34 Ga0466733_221979 3300042659 Bacteria 2428
35 Ga0466709_256047 3300042648 Bacteria 13143
36 Ga0466727_067963 3300042655 Bacteria 7888
37 Ga0466711_025110 3300042615 Bacteria 1561
38 Ga0466711_167984 3300042615 Bacteria 1497
39 Ga0466711_317871 3300042615 Bacteria 3642
40 Ga0466728_413842 3300042620 Bacteria 32190
41 Ga0466707_142706 3300042601 Bacteria 6826
42 Ga0466713_043591 3300042602 Bacteria 53812
43 Ga0466713_061927 3300042602 Bacteria 3913
44 Ga0466713_148719 3300042602 Bacteria 3888
45 Ga0466719_079607 3300042606 Bacteria 3973
46 Ga0103267_1000024 3300007190 Bacteria 70169
47 Ga0466705_372951 3300042612 Bacteria 1463
48 Ga0466733_162488 3300042659 Bacteria 9229
49 Ga0123353_10413153 3300010167 Bacteria 2003
50 Ga0466735_098810 3300042624 Bacteria 20686
51 Ga0466703_018901 3300042636 Bacteria 24174
52 Ga0466704_393127 3300042643 Bacteria 4615
53 Ga0466725_262013 3300042654 Bacteria 1679
54 Ga0466725_431778 3300042654 Bacteria 1905
55 Ga0466727_343818 3300042655 Bacteria 3455
56 Ga0466705_522705 3300042612 Bacteria 6254
57 Ga0466723_327503 3300042618 Archaea 7471
58 Ga0466691_035347 3300042593 Bacteria 17620
59 Ga0466696_350164 3300042596 Bacteria 3406
60 Ga0466707_213079 3300042601 Unclassified 8965
61 Ga0466713_102098 3300042602 Bacteria 100663
62 Ga0466714_149532 3300042603 Bacteria 13166
63 Ga0466733_017290 3300042659 Bacteria 27106
64 Ga0466735_047361 3300042624 Bacteria 1653
65 Ga0466735_164180 3300042624 Bacteria 1545
66 Ga0466703_172185 3300042636 Bacteria 3140
67 Ga0466708_107903 3300042652 Bacteria 16519
68 Ga0466711_293357 3300042615 Unclassified 2077
69 Ga0466728_141051 3300042620 Bacteria 14388
70 Ga0466728_336656 3300042620 Bacteria 3745
71 Ga0466690_100899 3300042590 Bacteria 5920
72 Ga0466696_089643 3300042596 Bacteria 20002
73 Ga0466696_131527 3300042596 Bacteria 4549
74 Ga0466696_470715 3300042596 Bacteria 15175
75 IMNBL1DRAFT_c0005884 3300000062 Bacteria 6870
76 Ga0466732_070379 3300042656 Bacteria 1574
77 Ga0466729_267547 3300042621 Unclassified 2189
78 Ga0466735_010112 3300042624 Bacteria 1968
79 Ga0466735_016538 3300042624 Bacteria 5575
80 Ga0466703_301701 3300042636 Bacteria 1786
81 Ga0466727_103521 3300042655 Bacteria 1936
82 Ga0466705_474314 3300042612 Bacteria 6398
83 Ga0466715_521573 3300042616 Bacteria 35190
84 Ga0466723_019223 3300042618 Bacteria 2202
85 Ga0466723_245046 3300042618 Bacteria 23052
86 Ga0466728_056248 3300042620 Bacteria 12378
87 Ga0466707_337640 3300042601 Bacteria 7376
88 Ga0466713_002225 3300042602 Bacteria 19977
89 Ga0466713_016019 3300042602 Bacteria 439221
90 Ga0466733_011384 3300042659 Unclassified 4550
91 Ga0466703_129511 3300042636 Bacteria 7141
92 Ga0466704_048773 3300042643 Bacteria 1381
93 Ga0466708_160759 3300042652 Bacteria 6120
94 Ga0466708_441997 3300042652 Bacteria 4039
95 Ga0466727_176210 3300042655 Bacteria 12726
96 Ga0466723_163242 3300042618 Bacteria 37968
97 Ga0466726_207734 3300042619 Bacteria 3658
98 Ga0466690_098357 3300042590 Bacteria 3964
99 Ga0466692_052654 3300042591 Bacteria 4085
100 Ga0466713_094532 3300042602 Bacteria 7756
101 Ga0466716_326861 3300042605 Bacteria 1044
102 Ga0068302_10384444 3300005071 Bacteria 4403
103 Ga0103267_1000075 3300007190 Bacteria 37650

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005071 Ga0068302_10384444 Ga0068302_103844441 218
2 3300042602 Ga0466713_043591 Ga0466713_043591_48292_49008 219
3 3300042652 Ga0466708_159923 Ga0466708_159923_9026_9685 219
4 3300042620 Ga0466728_056248 Ga0466728_056248_10478_11191 221
5 3300042624 Ga0466735_164180 Ga0466735_164180_655_1365 222
6 3300042654 Ga0466725_262013 Ga0466725_262013_751_1422 223
7 3300042615 Ga0466711_211713 Ga0466711_211713_23220_23936 224
8 3300042596 Ga0466696_350164 Ga0466696_350164_249_1004 227
9 3300042643 Ga0466704_527087 Ga0466704_527087_29_742 231
10 3300042605 Ga0466716_326861 Ga0466716_326861_86_844 233
11 3300042602 Ga0466713_061927 Ga0466713_061927_3024_3728 234
12 3300042602 Ga0466713_138308 Ga0466713_138308_238_942 234
13 3300042655 Ga0466727_176210 Ga0466727_176210_10954_11658 234
14 3300042602 Ga0466713_094532 Ga0466713_094532_2986_3693 235
15 3300042601 Ga0466707_091241 Ga0466707_091241_941_1651 236
16 3300042601 Ga0466707_142706 Ga0466707_142706_2833_3543 236
17 3300042601 Ga0466707_337640 Ga0466707_337640_5964_6674 236
18 3300042602 Ga0466713_148719 Ga0466713_148719_2638_3348 236
19 3300042615 Ga0466711_167984 Ga0466711_167984_722_1432 236
20 3300042620 Ga0466728_336656 Ga0466728_336656_700_1440 236
21 3300042624 Ga0466735_010112 Ga0466735_010112_827_1537 236
22 3300042624 Ga0466735_103066 Ga0466735_103066_1524_2234 236
23 3300042636 Ga0466703_018901 Ga0466703_018901_6164_6874 236
24 3300042643 Ga0466704_063151 Ga0466704_063151_37921_38631 236
25 3300042648 Ga0466709_256047 Ga0466709_256047_130_840 236
26 3300042591 Ga0466692_052654 Ga0466692_052654_477_1190 237
27 3300042591 Ga0466692_118383 Ga0466692_118383_10591_11304 237
28 3300042597 Ga0466699_147792 Ga0466699_147792_260_973 237
29 3300042601 Ga0466707_213079 Ga0466707_213079_1883_2596 237
30 3300042602 Ga0466713_002225 Ga0466713_002225_17866_18579 237
31 3300042602 Ga0466713_101233 Ga0466713_101233_8557_9270 237
32 3300042612 Ga0466705_372951 Ga0466705_372951_155_868 237
33 3300042612 Ga0466705_522705 Ga0466705_522705_4993_5706 237
34 3300042615 Ga0466711_293357 Ga0466711_293357_1301_2014 237
35 3300042615 Ga0466711_317871 Ga0466711_317871_2320_3033 237
36 3300042615 Ga0466711_319043 Ga0466711_319043_8033_8746 237
37 3300042616 Ga0466715_521573 Ga0466715_521573_15689_16402 237
38 3300042624 Ga0466735_098810 Ga0466735_098810_18230_18943 237
39 3300042636 Ga0466703_244452 Ga0466703_244452_56_769 237
40 3300042636 Ga0466703_301701 Ga0466703_301701_803_1516 237
41 3300042652 Ga0466708_441997 Ga0466708_441997_418_1131 237
42 iso_pr_bacteria 2910930387 2910932242 237
43 iso_pr_bacteria 2967483437 2967486889 237
44 3300042582 Ga0466657_323959 Ga0466657_323959_21625_22341 238
45 3300042590 Ga0466690_100899 Ga0466690_100899_4815_5531 238
46 3300042593 Ga0466691_043986 Ga0466691_043986_13968_14684 238
47 3300042601 Ga0466707_003738 Ga0466707_003738_597_1313 238
48 3300042602 Ga0466713_016019 Ga0466713_016019_179356_180072 238
49 3300042602 Ga0466713_017731 Ga0466713_017731_5458_6174 238
50 3300042602 Ga0466713_102098 Ga0466713_102098_90437_91153 238
51 3300042605 Ga0466716_288287 Ga0466716_288287_5251_5967 238
52 3300042610 Ga0466698_101594 Ga0466698_101594_371_1087 238
53 3300042612 Ga0466705_256370 Ga0466705_256370_17266_17982 238
54 3300042612 Ga0466705_474314 Ga0466705_474314_2711_3427 238
55 3300042618 Ga0466723_163242 Ga0466723_163242_5631_6347 238
56 3300042620 Ga0466728_141051 Ga0466728_141051_1294_2010 238
57 3300042621 Ga0466729_136757 Ga0466729_136757_23065_23781 238
58 3300042621 Ga0466729_267547 Ga0466729_267547_1229_1945 238
59 3300042636 Ga0466703_172185 Ga0466703_172185_1474_2190 238
60 3300042636 Ga0466703_339730 Ga0466703_339730_7326_8042 238
61 3300042643 Ga0466704_048773 Ga0466704_048773_541_1257 238
62 3300042655 Ga0466727_343818 Ga0466727_343818_47_763 238
63 3300042656 Ga0466732_070379 Ga0466732_070379_184_900 238
64 3300042659 Ga0466733_011384 Ga0466733_011384_1059_1775 238
65 3300042659 Ga0466733_017290 Ga0466733_017290_14510_15226 238
66 3300042659 Ga0466733_055432 Ga0466733_055432_16444_17160 238
67 3300042659 Ga0466733_089767 Ga0466733_089767_24437_25153 238
68 3300042659 Ga0466733_162488 Ga0466733_162488_4001_4717 238
69 iso_pr_bacteria 2695420314 2695471542 238
70 iso_pr_bacteria 2910926975 2910929153 238
71 iso_pr_bacteria 2910942425 2910943303 238
72 iso_pr_bacteria 2910959314 2910959573 238
73 iso_pr_bacteria 2940244548 2940244641 238
74 iso_pr_bacteria 2940248789 2940248882 238
75 iso_pr_bacteria 2940253009 2940253389 238
76 iso_pr_bacteria 2940257232 2940259648 238
77 iso_pr_bacteria 8100166142 8100167294 238
78 3300000062 IMNBL1DRAFT_c0005884 IMNBL1DRAFT_00058842 239
79 3300042590 Ga0466690_098357 Ga0466690_098357_754_1473 239
80 3300042596 Ga0466696_470715 Ga0466696_470715_12285_13004 239
81 3300042615 Ga0466711_107758 Ga0466711_107758_2199_2918 239
82 3300042616 Ga0466715_586438 Ga0466715_586438_57235_57954 239
83 3300042624 Ga0466735_016538 Ga0466735_016538_1921_2640 239
84 3300042654 Ga0466725_431778 Ga0466725_431778_29_748 239
85 3300042659 Ga0466733_221979 Ga0466733_221979_852_1571 239
86 iso_pr_bacteria 2820770630 2820771605 239
87 3300007190 Ga0103267_1000024 Ga0103267_100002421 240
88 3300007190 Ga0103267_1000075 Ga0103267_100007520 240
89 3300042603 Ga0466714_149532 Ga0466714_149532_10778_11500 240
90 3300042625 Ga0466730_075978 Ga0466730_075978_1667_2389 240
91 3300042616 Ga0466715_157130 Ga0466715_157130_2740_3465 241
92 3300000062 IMNBL1DRAFT_c0015266 IMNBL1DRAFT_00152663 242
93 3300010167 Ga0123353_10413153 Ga0123353_104131532 242
94 3300042593 Ga0466691_035347 Ga0466691_035347_12258_12986 242
95 3300042596 Ga0466696_089643 Ga0466696_089643_9040_9768 242
96 3300042596 Ga0466696_131527 Ga0466696_131527_1515_2243 242
97 3300042605 Ga0466716_134562 Ga0466716_134562_6993_7721 242
98 3300042612 Ga0466705_017710 Ga0466705_017710_506_1234 242
99 3300042618 Ga0466723_019223 Ga0466723_019223_561_1289 242
100 3300042619 Ga0466726_207734 Ga0466726_207734_411_1139 242
101 3300042620 Ga0466728_064211 Ga0466728_064211_2312_3040 242
102 3300042620 Ga0466728_413842 Ga0466728_413842_10443_11171 242
103 3300042636 Ga0466703_129511 Ga0466703_129511_4908_5636 242
104 3300042643 Ga0466704_393127 Ga0466704_393127_2121_2849 242
105 3300042655 Ga0466727_067963 Ga0466727_067963_4758_5486 242
106 3300042655 Ga0466727_103521 Ga0466727_103521_949_1677 242
107 3300042596 Ga0466696_477025 Ga0466696_477025_451_1182 243
108 3300042618 Ga0466723_245046 Ga0466723_245046_21425_22156 243
109 3300042596 Ga0466696_027337 Ga0466696_027337_395_1135 246
110 3300042615 Ga0466711_025110 Ga0466711_025110_560_1300 246
111 3300042618 Ga0466723_327503 Ga0466723_327503_2772_3518 248
112 3300042624 Ga0466735_047361 Ga0466735_047361_159_908 249
113 3300042652 Ga0466708_160759 Ga0466708_160759_4994_5755 253
114 3300042606 Ga0466719_079607 Ga0466719_079607_3096_3863 255
115 3300042652 Ga0466708_107903 Ga0466708_107903_14843_15625 260

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00535 Glycos_transf_2 Glycosyl transferase family 2 8 178 0.89
PF10111 Glyco_tranf_2_2 Glycosyltransferase like family 2 8 115 0.84

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.