Protein Family IF08120

Metagenome Isolate
155 Members
47 Samples
148 Scaffolds
229.28 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_214031|Ga0466723_214031_104_940
Length
278 aa
Sequence
MPVSLLDRKLRAFVPIVLSAFPSRPVSPKMVAETGGDVYTVNMTRGILIAGNGSSLCAAIEAEIARRVKHFTLALIPNRLPGSTNSAADAFSEKTSPPSGHEARIPLVWNPGSPVSARTLVIAAENRLEHINEAILICSPPSVRRAAAELAPGDIEIMVNDHIKGWFYLVKELAAVFRARRAGSLALVFSETGPGGGRDDAADILGPAALASFRAFTQSVLASALNEPYQTMAFSSSEAGAEAAFAAFIVKQLDEGNKRSNGKWHRFGKLNLFGRLPR

📊 Sample Types

Isolate 4.5%
Metagenome 95.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 42.2%
Kalotermitidae 31.1%
Unclassified 15.6%
Termopsidae 6.7%
Rhinotermitidae 4.4%

🌳 Taxonomy

Archaea 0
Bacteria 145
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
2 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
8 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
9 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
10 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
11 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
12 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
13 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
14 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
15 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
16 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
21 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
22 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
23 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
24 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
25 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
26 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
27 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
28 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
29 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
30 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
31 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
32 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
33 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
34 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
35 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
36 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
37 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
38 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
39 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
40 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
41 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
42 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
43 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
44 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
45 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
46 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
47 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_059342 3300042612 Bacteria 8583
2 Ga0466705_156097 3300042612 Bacteria 1900
3 Ga0466732_257077 3300042656 Bacteria 1759
4 Ga0466733_067829 3300042659 Bacteria 52214
5 JGI24700J35501_10929298 3300002508 Bacteria 8992
6 Ga0466703_204244 3300042636 Bacteria 2932
7 Ga0466704_161582 3300042643 Bacteria 9235
8 Ga0466704_363378 3300042643 Bacteria 6622
9 Ga0466708_095269 3300042652 Bacteria 23314
10 Ga0466708_354221 3300042652 Bacteria 5388
11 Ga0123356_10009736 3300010049 Bacteria 9473
12 Ga0466711_272301 3300042615 Unclassified 1273
13 Ga0466715_518779 3300042616 Bacteria 13891
14 Ga0466718_100759 3300042617 Bacteria 9859
15 Ga0466723_098489 3300042618 Bacteria 1825
16 Ga0466723_214031 3300042618 Bacteria 5701
17 Ga0466728_211325 3300042620 Bacteria 2239
18 Ga0466707_378333 3300042601 Bacteria 2619
19 Ga0466719_322581 3300042606 Bacteria 2152
20 Ga0466720_008850 3300042607 Bacteria 13895
21 Ga0466722_082630 3300042609 Bacteria 4277
22 AustNasuHG_c1054669 3300000089 Unclassified 819
23 JGI24698J34947_10012297 3300002449 Bacteria 4690
24 Ga0264413_119507 3300024493 Bacteria 2808
25 Ga0466692_028229 3300042591 Bacteria 2594
26 Ga0466735_193858 3300042624 Bacteria 1193
27 Ga0466735_208325 3300042624 Bacteria 2057
28 Ga0466703_114433 3300042636 Bacteria 25250
29 Ga0466704_085505 3300042643 Bacteria 3115
30 Ga0466704_105401 3300042643 Bacteria 16631
31 Ga0466704_221950 3300042643 Bacteria 12708
32 Ga0466709_278652 3300042648 Bacteria 4877
33 Ga0466715_149946 3300042616 Bacteria 9129
34 Ga0466715_462355 3300042616 Bacteria 6348
35 Ga0466707_060702 3300042601 Bacteria 1117
36 Ga0466719_331021 3300042606 Bacteria 12140
37 Ga0466720_049532 3300042607 Bacteria 16419
38 Ga0466722_146764 3300042609 Bacteria 1708
39 Ga0264413_114559 3300024493 Bacteria 1504
40 Ga0466690_370030 3300042590 Bacteria 1474
41 Ga0466691_099306 3300042593 Bacteria 9231
42 Ga0466696_335197 3300042596 Bacteria 35443
43 Ga0466705_493591 3300042612 Bacteria 8868
44 Ga0466718_149924 3300042617 Bacteria 2804
45 Ga0466726_446928 3300042619 Bacteria 2226
46 Ga0466707_182588 3300042601 Bacteria 3129
47 Ga0466720_089305 3300042607 Bacteria 26279
48 Ga0466722_250853 3300042609 Bacteria 2951
49 Ga0466732_134604 3300042656 Bacteria 32211
50 JGI24695J34938_10013157 3300002450 Bacteria 4356
51 Ga0072941_1036567 3300005201 Bacteria 7109
52 Ga0074263_101482 3300005485 Bacteria 2441
53 Ga0264413_109836 3300024493 Bacteria 6419
54 Ga0415639_005755 3300038395 Bacteria 14243
55 Ga0466657_286143 3300042582 Unclassified 1741
56 Ga0466691_026337 3300042593 Bacteria 4567
57 Ga0466696_358939 3300042596 Bacteria 9447
58 Ga0466709_150278 3300042648 Bacteria 2550
59 Ga0123356_10460933 3300010049 Bacteria 1421
60 Ga0466718_017957 3300042617 Bacteria 5255
61 Ga0466718_148333 3300042617 Bacteria 1961
62 Ga0466723_099592 3300042618 Bacteria 2901
63 Ga0466707_009568 3300042601 Bacteria 18472
64 Ga0466719_125599 3300042606 Bacteria 2366
65 Ga0466720_037794 3300042607 Bacteria 2327
66 Ga0466720_140465 3300042607 Bacteria 33994
67 Ga0466721_089995 3300042608 Bacteria 1502
68 Ga0466722_164709 3300042609 Bacteria 1970
69 Ga0466705_108466 3300042612 Bacteria 4232
70 Ga0466705_319684 3300042612 Bacteria 1274
71 AustNasuHG_c1017153 3300000089 Bacteria 2412
72 JGI24698J34947_10014510 3300002449 Bacteria 4290
73 JGI24695J34938_10001354 3300002450 Bacteria 21183
74 JGI24695J34938_10012204 3300002450 Bacteria 4572
75 Ga0072941_1007171 3300005201 Bacteria 1192
76 Ga0074263_108093 3300005485 Unclassified 1541
77 Ga0264413_103394 3300024493 Bacteria 29703
78 Ga0466704_060382 3300042643 Bacteria 33102
79 Ga0466704_553727 3300042643 Bacteria 10426
80 Ga0466709_105159 3300042648 Bacteria 2079
81 Ga0123355_10223478 3300009826 Bacteria 2703
82 Ga0123353_10010397 3300010167 Bacteria 12969
83 Ga0466711_123858 3300042615 Bacteria 8835
84 Ga0466715_199087 3300042616 Bacteria 2648
85 Ga0466715_480954 3300042616 Bacteria 9685
86 Ga0466718_005186 3300042617 Bacteria 3835
87 Ga0466719_240468 3300042606 Bacteria 11454
88 Ga0466720_082573 3300042607 Unclassified 8384
89 Ga0466722_004336 3300042609 Bacteria 2911
90 Ga0466705_123140 3300042612 Unclassified 7647
91 Ga0466732_164744 3300042656 Bacteria 2026
92 Ga0264413_145808 3300024493 Bacteria 1280
93 Ga0466690_152434 3300042590 Bacteria 4145
94 Ga0466692_200136 3300042591 Bacteria 1441
95 Ga0466694_201107 3300042594 Bacteria 1223
96 Ga0466696_034301 3300042596 Bacteria 10376
97 Ga0466703_415772 3300042636 Bacteria 16052
98 Ga0466708_009809 3300042652 Bacteria 1193
99 Ga0466708_110398 3300042652 Unclassified 1654
100 Ga0466708_174708 3300042652 Bacteria 7695
101 Ga0466711_340078 3300042615 Bacteria 2106
102 Ga0466715_353571 3300042616 Bacteria 3200
103 Ga0466718_024458 3300042617 Bacteria 1840
104 Ga0466726_082421 3300042619 Bacteria 6500
105 Ga0466728_344929 3300042620 Bacteria 7425
106 Ga0466716_316129 3300042605 Bacteria 1692
107 Ga0466719_203915 3300042606 Bacteria 5191
108 Ga0466720_043305 3300042607 Bacteria 11476
109 Ga0466720_179504 3300042607 Bacteria 13268
110 Ga0466722_216131 3300042609 Bacteria 2372
111 AustNasuHG_c1000124 3300000089 Bacteria 23612
112 AustNasuHG_c1001079 3300000089 Bacteria 9787
113 AustNasuHG_c1009194 3300000089 Bacteria 3475
114 Ga0068302_10140289 3300005071 Bacteria 1745
115 Ga0072940_1083888 3300005200 Bacteria 1867
116 Ga0466735_044275 3300042624 Bacteria 1437
117 Ga0466703_023240 3300042636 Bacteria 3748
118 Ga0466703_152392 3300042636 Bacteria 4932
119 Ga0466704_080929 3300042643 Bacteria 7592
120 Ga0466708_050622 3300042652 Bacteria 3979
121 Ga0466715_116608 3300042616 Bacteria 2665
122 Ga0466707_295821 3300042601 Bacteria 5048
123 Ga0466716_267744 3300042605 Bacteria 1642
124 Ga0466719_076717 3300042606 Bacteria 18973
125 Ga0466720_039028 3300042607 Unclassified 8481
126 Ga0466720_062105 3300042607 Bacteria 20445
127 Ga0466721_191339 3300042608 Bacteria 79638
128 Ga0466705_006996 3300042612 Bacteria 7384
129 Ga0466732_026046 3300042656 Bacteria 5488
130 AustNasuHG_c1026297 3300000089 Bacteria 1814
131 JGI24695J34938_10000369 3300002450 Bacteria 44536
132 Ga0466691_102083 3300042593 Bacteria 3301
133 Ga0466694_063558 3300042594 Bacteria 34055
134 Ga0466694_166355 3300042594 Bacteria 109748
135 Ga0466735_074594 3300042624 Bacteria 2724
136 Ga0466702_218870 3300042635 Bacteria 2621
137 Ga0466702_324209 3300042635 Bacteria 11014
138 Ga0466704_469199 3300042643 Bacteria 10867
139 Ga0466709_036911 3300042648 Bacteria 6422
140 Ga0466709_383443 3300042648 Bacteria 5520
141 Ga0466708_351943 3300042652 Bacteria 4342
142 Ga0466712_036241 3300042614 Unclassified 4493
143 Ga0466712_110702 3300042614 Unclassified 6062
144 Ga0466718_037729 3300042617 Bacteria 1098
145 Ga0466728_463947 3300042620 Bacteria 5979
146 Ga0466720_008029 3300042607 Bacteria 1802
147 Ga0466720_060354 3300042607 Bacteria 7733
148 Ga0466720_149902 3300042607 Bacteria 23595

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300024493 Ga0264413_114559 Ga0264413_1145592 206
2 3300042607 Ga0466720_008029 Ga0466720_008029_1115_1774 219
3 3300042594 Ga0466694_166355 Ga0466694_166355_97468_98133 221
4 3300005201 Ga0072941_1036567 Ga0072941_10365673 222
5 3300024493 Ga0264413_109836 Ga0264413_1098362 222
6 3300024493 Ga0264413_119507 Ga0264413_1195075 222
7 3300042594 Ga0466694_063558 Ga0466694_063558_14307_14975 222
8 3300042607 Ga0466720_008850 Ga0466720_008850_3587_4255 222
9 3300042607 Ga0466720_039028 Ga0466720_039028_5315_5983 222
10 3300042607 Ga0466720_049532 Ga0466720_049532_6549_7217 222
11 3300042607 Ga0466720_140465 Ga0466720_140465_26078_26746 222
12 3300042614 Ga0466712_036241 Ga0466712_036241_2753_3421 222
13 3300042614 Ga0466712_110702 Ga0466712_110702_4552_5220 222
14 3300042617 Ga0466718_100759 Ga0466718_100759_4021_4689 222
15 3300042617 Ga0466718_148333 Ga0466718_148333_1247_1915 222
16 3300042656 Ga0466732_026046 Ga0466732_026046_2899_3567 222
17 3300042656 Ga0466732_134604 Ga0466732_134604_12406_13074 222
18 3300042656 Ga0466732_164744 Ga0466732_164744_1139_1807 222
19 3300042656 Ga0466732_257077 Ga0466732_257077_366_1034 222
20 iso_pr_bacteria 2781125648 2781304929 222
21 3300000089 AustNasuHG_c1001079 AustNasuHG_100107911 223
22 3300000089 AustNasuHG_c1009194 AustNasuHG_10091941 223
23 3300000089 AustNasuHG_c1017153 AustNasuHG_10171532 223
24 3300000089 AustNasuHG_c1054669 AustNasuHG_10546691 223
25 3300002449 JGI24698J34947_10012297 JGI24698J34947_100122972 223
26 3300002449 JGI24698J34947_10014510 JGI24698J34947_100145103 223
27 3300002450 JGI24695J34938_10000369 JGI24695J34938_1000036938 223
28 3300005201 Ga0072941_1007171 Ga0072941_10071711 223
29 3300005485 Ga0074263_101482 Ga0074263_1014822 223
30 3300010049 Ga0123356_10009736 Ga0123356_100097369 223
31 3300038395 Ga0415639_005755 Ga0415639_005755_9004_9675 223
32 3300042601 Ga0466707_295821 Ga0466707_295821_4291_4962 223
33 3300042607 Ga0466720_037794 Ga0466720_037794_795_1466 223
34 3300042609 Ga0466722_250853 Ga0466722_250853_2194_2865 223
35 3300042612 Ga0466705_493591 Ga0466705_493591_5253_5924 223
36 3300042615 Ga0466711_123858 Ga0466711_123858_7851_8522 223
37 3300042620 Ga0466728_463947 Ga0466728_463947_993_1664 223
38 3300042643 Ga0466704_363378 Ga0466704_363378_2403_3074 223
39 3300042652 Ga0466708_009809 Ga0466708_009809_112_783 223
40 3300042652 Ga0466708_110398 Ga0466708_110398_640_1311 223
41 3300042652 Ga0466708_354221 Ga0466708_354221_4674_5345 223
42 3300000089 AustNasuHG_c1026297 AustNasuHG_10262972 224
43 3300042594 Ga0466694_201107 Ga0466694_201107_58_732 224
44 3300042606 Ga0466719_076717 Ga0466719_076717_8941_9615 224
45 3300042612 Ga0466705_059342 Ga0466705_059342_3593_4267 224
46 3300042620 Ga0466728_344929 Ga0466728_344929_468_1142 224
47 3300042636 Ga0466703_023240 Ga0466703_023240_209_883 224
48 3300042643 Ga0466704_161582 Ga0466704_161582_249_923 224
49 3300042648 Ga0466709_278652 Ga0466709_278652_3927_4601 224
50 3300042659 Ga0466733_067829 Ga0466733_067829_30226_30900 224
51 iso_pr_bacteria 2781125641 2781290418 224
52 iso_pr_bacteria 2781125641 2781290540 224
53 3300002450 JGI24695J34938_10012204 JGI24695J34938_100122043 225
54 3300002450 JGI24695J34938_10013157 JGI24695J34938_100131572 225
55 3300010167 Ga0123353_10010397 Ga0123353_100103975 225
56 3300042582 Ga0466657_286143 Ga0466657_286143_494_1171 225
57 3300042593 Ga0466691_102083 Ga0466691_102083_1915_2592 225
58 3300042601 Ga0466707_378333 Ga0466707_378333_257_934 225
59 3300042612 Ga0466705_319684 Ga0466705_319684_169_846 225
60 3300042617 Ga0466718_149924 Ga0466718_149924_51_728 225
61 3300042618 Ga0466723_099592 Ga0466723_099592_1624_2301 225
62 3300042619 Ga0466726_082421 Ga0466726_082421_1208_1885 225
63 3300042619 Ga0466726_446928 Ga0466726_446928_802_1479 225
64 3300042624 Ga0466735_074594 Ga0466735_074594_1107_1784 225
65 3300042624 Ga0466735_208325 Ga0466735_208325_85_762 225
66 3300042648 Ga0466709_105159 Ga0466709_105159_1269_1946 225
67 3300005071 Ga0068302_10140289 Ga0068302_101402892 226
68 3300005485 Ga0074263_108093 Ga0074263_1080932 226
69 3300042617 Ga0466718_005186 Ga0466718_005186_2338_3018 226
70 3300042617 Ga0466718_024458 Ga0466718_024458_115_795 226
71 3300002450 JGI24695J34938_10001354 JGI24695J34938_100013542 227
72 3300024493 Ga0264413_145808 Ga0264413_1458082 227
73 3300042590 Ga0466690_152434 Ga0466690_152434_2256_2939 227
74 3300042616 Ga0466715_149946 Ga0466715_149946_4291_4974 227
75 3300042635 Ga0466702_324209 Ga0466702_324209_5675_6358 227
76 3300042636 Ga0466703_114433 Ga0466703_114433_12195_12878 227
77 3300042643 Ga0466704_060382 Ga0466704_060382_8080_8763 227
78 3300042643 Ga0466704_553727 Ga0466704_553727_1096_1779 227
79 3300042648 Ga0466709_036911 Ga0466709_036911_146_829 227
80 3300042648 Ga0466709_383443 Ga0466709_383443_149_832 227
81 3300042652 Ga0466708_050622 Ga0466708_050622_2497_3180 227
82 3300042652 Ga0466708_174708 Ga0466708_174708_5194_5877 227
83 iso_pr_bacteria 2781125692 2781431385 227
84 3300042591 Ga0466692_028229 Ga0466692_028229_1740_2426 228
85 3300042601 Ga0466707_009568 Ga0466707_009568_8846_9532 228
86 3300042608 Ga0466721_089995 Ga0466721_089995_677_1363 228
87 3300042609 Ga0466722_216131 Ga0466722_216131_207_893 228
88 3300042624 Ga0466735_044275 Ga0466735_044275_156_842 228
89 3300005200 Ga0072940_1083888 Ga0072940_10838883 229
90 3300010049 Ga0123356_10460933 Ga0123356_104609332 229
91 3300042591 Ga0466692_200136 Ga0466692_200136_157_846 229
92 3300042601 Ga0466707_060702 Ga0466707_060702_58_747 229
93 3300042606 Ga0466719_331021 Ga0466719_331021_96_785 229
94 3300042609 Ga0466722_082630 Ga0466722_082630_3455_4144 229
95 3300042612 Ga0466705_123140 Ga0466705_123140_6619_7308 229
96 3300042616 Ga0466715_116608 Ga0466715_116608_1416_2105 229
97 3300042635 Ga0466702_218870 Ga0466702_218870_77_766 229
98 3300042643 Ga0466704_085505 Ga0466704_085505_173_862 229
99 3300042643 Ga0466704_105401 Ga0466704_105401_14192_14881 229
100 3300042643 Ga0466704_469199 Ga0466704_469199_9786_10475 229
101 3300042593 Ga0466691_099306 Ga0466691_099306_3429_4121 230
102 3300042616 Ga0466715_518779 Ga0466715_518779_10751_11443 230
103 3300042643 Ga0466704_221950 Ga0466704_221950_7020_7712 230
104 3300042593 Ga0466691_026337 Ga0466691_026337_1597_2292 231
105 3300042596 Ga0466696_034301 Ga0466696_034301_1987_2682 231
106 3300042596 Ga0466696_335197 Ga0466696_335197_34563_35258 231
107 3300042606 Ga0466719_203915 Ga0466719_203915_2612_3307 231
108 3300042608 Ga0466721_191339 Ga0466721_191339_9633_10328 231
109 3300042636 Ga0466703_204244 Ga0466703_204244_1590_2285 231
110 3300042643 Ga0466704_080929 Ga0466704_080929_3322_4017 231
111 iso_pr_bacteria 2781125656 2781322179 231
112 3300000089 AustNasuHG_c1000124 AustNasuHG_100012414 232
113 3300009826 Ga0123355_10223478 Ga0123355_102234785 232
114 3300024493 Ga0264413_103394 Ga0264413_1033945 232
115 3300042596 Ga0466696_358939 Ga0466696_358939_8454_9152 232
116 3300042606 Ga0466719_240468 Ga0466719_240468_714_1412 232
117 3300042609 Ga0466722_146764 Ga0466722_146764_296_994 232
118 3300042609 Ga0466722_164709 Ga0466722_164709_39_737 232
119 3300042607 Ga0466720_043305 Ga0466720_043305_7021_7722 233
120 3300042607 Ga0466720_060354 Ga0466720_060354_5233_5934 233
121 3300042607 Ga0466720_179504 Ga0466720_179504_5226_5927 233
122 3300042617 Ga0466718_017957 Ga0466718_017957_100_801 233
123 3300042617 Ga0466718_037729 Ga0466718_037729_267_968 233
124 iso_pr_bacteria 2819994798 2819995961 233
125 3300002508 JGI24700J35501_10929298 JGI24700J35501_109292985 234
126 3300042607 Ga0466720_082573 Ga0466720_082573_4244_5020 234
127 3300042615 Ga0466711_272301 Ga0466711_272301_92_796 234
128 3300042615 Ga0466711_340078 Ga0466711_340078_1269_1973 234
129 3300042609 Ga0466722_004336 Ga0466722_004336_327_1034 235
130 3300042620 Ga0466728_211325 Ga0466728_211325_570_1277 235
131 iso_pr_bacteria 2781125633 2781272734 235
132 3300042616 Ga0466715_199087 Ga0466715_199087_878_1588 236
133 3300042648 Ga0466709_150278 Ga0466709_150278_1633_2343 236
134 3300042605 Ga0466716_316129 Ga0466716_316129_86_799 237
135 3300042612 Ga0466705_156097 Ga0466705_156097_810_1523 237
136 3300042636 Ga0466703_415772 Ga0466703_415772_9703_10416 237
137 3300042652 Ga0466708_095269 Ga0466708_095269_2108_2821 237
138 3300042601 Ga0466707_182588 Ga0466707_182588_2188_2904 238
139 3300042616 Ga0466715_462355 Ga0466715_462355_954_1670 238
140 3300042616 Ga0466715_480954 Ga0466715_480954_6704_7450 238
141 3300042607 Ga0466720_062105 Ga0466720_062105_1777_2496 239
142 3300042607 Ga0466720_089305 Ga0466720_089305_12195_12914 239
143 3300042636 Ga0466703_152392 Ga0466703_152392_2920_3639 239
144 3300042605 Ga0466716_267744 Ga0466716_267744_478_1221 240
145 3300042616 Ga0466715_353571 Ga0466715_353571_737_1477 240
146 3300042652 Ga0466708_351943 Ga0466708_351943_394_1116 240
147 3300042612 Ga0466705_006996 Ga0466705_006996_774_1499 241
148 3300042590 Ga0466690_370030 Ga0466690_370030_348_1091 247
149 3300042606 Ga0466719_322581 Ga0466719_322581_58_801 247
150 3300042618 Ga0466723_098489 Ga0466723_098489_340_1092 250
151 3300042606 Ga0466719_125599 Ga0466719_125599_1220_1978 252
152 3300042624 Ga0466735_193858 Ga0466735_193858_182_967 261
153 3300042607 Ga0466720_149902 Ga0466720_149902_16909_17703 264
154 3300042612 Ga0466705_108466 Ga0466705_108466_252_1103 267
155 3300042618 Ga0466723_214031 Ga0466723_214031_104_940 278

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.