Protein Family IF08104

Metagenome Isolate
240 Members
51 Samples
232 Scaffolds
475.65 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_183954|Ga0466723_183954_4900_6336
Length
461 aa
Sequence
MFEEALSYDDVLLLPGHSEILPRDCDVRTTLCGALRLNVPVISAAMDTVTEEKFAIAIALEGGTGVIHRNLSPEEQARQVGNVKRYLNWIIDSPVTVGEDALVRDVKSLKEKFQVSGMPVLNSEGRLVGIITSRDLRFCRDDSLPVKDVMTRNPVVVQGEPSVSGAREKFDKHRIEKLPVTDAEGRLTGLITVKDMEKHDRFPRADFEQRLPLLKNVKVDYVVLDTAHGDTKNVMEAVRKIRKRFGIPVIGGNVASREGTRRLIEAGADAVKVGIGPGSICTTRIVAGIGVPQFTAVWECAGEAAKSGIPVIADGGIKFSGDITKAIGAGADMVMIGNLFAGLKEAPGNEIIFDGRIYKEYRGMGSLGAINDGAGDRYQLTKDEEPVPEGIEGRVPYKGELRSYLNQLVSGLRKGMGYCGCKNIEELKRYRKFVKITAAGFKESHAHDVTITQEAPNYSRS

πŸ“Š Sample Types

Isolate 3.3%
Metagenome 96.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 35.3%
Kalotermitidae 27.5%
Unclassified 19.6%
Rhinotermitidae 7.8%
Termopsidae 5.9%
Blaberidae 2.0%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 218
Eukaryota 0
Viruses 0
Unclassified 22

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
5 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
10 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
11 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
12 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
13 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
14 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
15 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
16 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
17 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
18 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
19 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
20 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
21 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
22 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
23 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
24 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
25 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
26 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
27 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
28 2772190975 Treponema sp. RmG30 Isolate Blaberidae
29 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
30 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
31 650716102 Treponema primitia ZAS-2 Isolate Unclassified
32 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
33 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
34 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
35 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
36 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
37 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
38 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
39 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
40 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
41 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
42 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
43 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
44 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
45 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
46 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
47 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
48 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
49 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
50 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
51 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_093071 3300042612 Bacteria 7096
2 Ga0466733_087939 3300042659 Bacteria 4042
3 Ga0466733_106142 3300042659 Bacteria 10504
4 Ga0466735_098886 3300042624 Bacteria 10381
5 Ga0466703_224292 3300042636 Bacteria 7915
6 Ga0466703_358780 3300042636 Bacteria 3415
7 Ga0466704_220972 3300042643 Unclassified 2372
8 Ga0466704_254801 3300042643 Bacteria 10052
9 Ga0466709_074784 3300042648 Bacteria 7260
10 Ga0466709_297537 3300042648 Bacteria 19155
11 Ga0466708_040230 3300042652 Bacteria 2106
12 Ga0466708_151255 3300042652 Bacteria 7070
13 Ga0466708_285658 3300042652 Bacteria 58408
14 Ga0466708_348891 3300042652 Bacteria 3986
15 Ga0466727_114339 3300042655 Bacteria 2093
16 Ga0466716_254094 3300042605 Bacteria 4243
17 Ga0466716_339591 3300042605 Bacteria 5498
18 Ga0466719_187827 3300042606 Bacteria 4515
19 Ga0466720_044345 3300042607 Bacteria 4904
20 Ga0466720_209844 3300042607 Bacteria 24188
21 Ga0466722_187158 3300042609 Bacteria 11331
22 Ga0466722_191869 3300042609 Bacteria 6897
23 Ga0466722_223987 3300042609 Bacteria 9516
24 Ga0466722_243957 3300042609 Bacteria 3525
25 Ga0466712_049786 3300042614 Bacteria 9773
26 Ga0466712_151172 3300042614 Bacteria 5328
27 Ga0466715_013386 3300042616 Bacteria 3206
28 Ga0466715_037085 3300042616 Bacteria 4055
29 Ga0466715_059331 3300042616 Bacteria 9132
30 Ga0466715_349603 3300042616 Unclassified 5633
31 Ga0466723_159008 3300042618 Bacteria 56322
32 Ga0466726_187217 3300042619 Bacteria 2996
33 Ga0466729_084385 3300042621 Bacteria 3403
34 Ga0123353_10148960 3300010167 Bacteria 3739
35 Ga0466693_353122 3300042592 Bacteria 2089
36 Ga0466691_095697 3300042593 Bacteria 3329
37 Ga0466691_105805 3300042593 Bacteria 8543
38 Ga0466691_128234 3300042593 Bacteria 4019
39 Ga0466691_147028 3300042593 Bacteria 14581
40 Ga0466696_017879 3300042596 Bacteria 11346
41 Ga0466696_288965 3300042596 Bacteria 2786
42 JGI24700J35501_10930330 3300002508 Bacteria 13075
43 Ga0466705_057988 3300042612 Unclassified 2870
44 Ga0466705_086245 3300042612 Unclassified 1763
45 Ga0466705_104460 3300042612 Bacteria 2682
46 Ga0466705_159269 3300042612 Bacteria 4351
47 Ga0466705_260214 3300042612 Bacteria 4336
48 Ga0466703_028972 3300042636 Bacteria 5552
49 Ga0466704_140159 3300042643 Bacteria 23373
50 Ga0466709_392983 3300042648 Bacteria 3038
51 Ga0466708_127532 3300042652 Bacteria 8006
52 Ga0466716_201290 3300042605 Bacteria 10412
53 Ga0466720_012390 3300042607 Bacteria 4685
54 Ga0466722_222964 3300042609 Bacteria 20370
55 Ga0466711_048011 3300042615 Bacteria 9509
56 Ga0466711_163973 3300042615 Bacteria 5208
57 Ga0466711_294734 3300042615 Bacteria 19689
58 Ga0466715_075991 3300042616 Bacteria 14077
59 Ga0466715_408251 3300042616 Bacteria 8705
60 Ga0466723_036199 3300042618 Bacteria 24106
61 Ga0466723_092273 3300042618 Bacteria 3082
62 Ga0466723_263331 3300042618 Bacteria 6828
63 Ga0466723_310211 3300042618 Bacteria 9194
64 Ga0466726_100680 3300042619 Bacteria 5550
65 Ga0466726_177957 3300042619 Bacteria 16745
66 Ga0123353_10205569 3300010167 Unclassified 3093
67 Ga0456237_0001572 3300041968 Bacteria 3647
68 Ga0466690_270102 3300042590 Bacteria 9900
69 Ga0466690_286042 3300042590 Bacteria 4151
70 Ga0466691_011266 3300042593 Bacteria 4692
71 Ga0466696_273947 3300042596 Bacteria 15532
72 Ga0466699_016990 3300042597 Bacteria 7604
73 AustNasuHG_c1000930 3300000089 Bacteria 10577
74 JGI24702J35022_10006689 3300002462 Bacteria 6650
75 Ga0466705_011525 3300042612 Unclassified 4302
76 Ga0466705_064073 3300042612 Bacteria 7273
77 Ga0466703_175340 3300042636 Bacteria 3373
78 Ga0466709_416037 3300042648 Bacteria 1700
79 Ga0466708_286264 3300042652 Bacteria 107074
80 Ga0466708_303986 3300042652 Bacteria 11145
81 Ga0466707_189457 3300042601 Bacteria 1622
82 Ga0466716_001631 3300042605 Bacteria 6000
83 Ga0466719_191445 3300042606 Bacteria 3020
84 Ga0466720_053051 3300042607 Bacteria 11845
85 Ga0466722_036609 3300042609 Bacteria 22552
86 Ga0466705_530508 3300042612 Unclassified 5176
87 Ga0466715_329218 3300042616 Bacteria 23323
88 Ga0466715_643978 3300042616 Bacteria 3677
89 Ga0466723_124226 3300042618 Bacteria 3059
90 Ga0466723_333951 3300042618 Bacteria 11771
91 Ga0466728_012178 3300042620 Bacteria 3404
92 Ga0466728_195879 3300042620 Bacteria 4667
93 Ga0123356_10040224 3300010049 Bacteria 4356
94 Ga0123353_10441554 3300010167 Bacteria 1919
95 Ga0415639_011024 3300038395 Unclassified 5124
96 Ga0466690_253353 3300042590 Bacteria 6696
97 Ga0466692_061217 3300042591 Bacteria 34862
98 Ga0466691_073031 3300042593 Unclassified 3129
99 Ga0466691_105957 3300042593 Bacteria 3011
100 Ga0466696_023816 3300042596 Bacteria 3825
101 Ga0466696_298009 3300042596 Bacteria 8563
102 Ga0466696_352716 3300042596 Bacteria 41032
103 Ga0068305_10032411 3300005083 Bacteria 7707
104 Ga0466732_231735 3300042656 Bacteria 1579
105 Ga0466703_037865 3300042636 Unclassified 4261
106 Ga0466703_272773 3300042636 Bacteria 4353
107 Ga0466704_312082 3300042643 Bacteria 3552
108 Ga0466704_457484 3300042643 Bacteria 17915
109 Ga0466709_160100 3300042648 Bacteria 9896
110 Ga0466708_160968 3300042652 Bacteria 3548
111 Ga0466727_077429 3300042655 Bacteria 6873
112 Ga0466727_147857 3300042655 Bacteria 5349
113 Ga0466716_092401 3300042605 Bacteria 4835
114 Ga0466719_044531 3300042606 Bacteria 7082
115 Ga0466719_059752 3300042606 Bacteria 19078
116 Ga0466719_070963 3300042606 Bacteria 7007
117 Ga0466719_126290 3300042606 Bacteria 14763
118 Ga0466719_128679 3300042606 Bacteria 4630
119 Ga0466719_491825 3300042606 Bacteria 5378
120 Ga0466720_020932 3300042607 Bacteria 8983
121 Ga0466720_152963 3300042607 Unclassified 3095
122 Ga0466722_154505 3300042609 Bacteria 9599
123 Ga0466712_202636 3300042614 Bacteria 10117
124 Ga0466711_028445 3300042615 Bacteria 14670
125 Ga0466711_076850 3300042615 Bacteria 18451
126 Ga0466711_364950 3300042615 Bacteria 8371
127 Ga0466715_334917 3300042616 Bacteria 12590
128 Ga0466715_498542 3300042616 Bacteria 3097
129 Ga0466718_022413 3300042617 Bacteria 8106
130 Ga0466718_031913 3300042617 Bacteria 14989
131 Ga0466718_139620 3300042617 Bacteria 2449
132 Ga0466723_022695 3300042618 Bacteria 15683
133 Ga0466726_164932 3300042619 Bacteria 2153
134 Ga0123355_10016969 3300009826 Bacteria 11491
135 Ga0456237_0002972 3300041968 Bacteria 2755
136 Ga0466690_005348 3300042590 Bacteria 17626
137 Ga0466690_182665 3300042590 Bacteria 9441
138 Ga0466692_011152 3300042591 Bacteria 10393
139 Ga0466692_122932 3300042591 Bacteria 14135
140 Ga0466691_049961 3300042593 Bacteria 3743
141 Ga0466696_005818 3300042596 Bacteria 27640
142 Ga0466696_071528 3300042596 Bacteria 16884
143 Ga0466696_097603 3300042596 Bacteria 8107
144 Ga0466703_005691 3300042636 Bacteria 3652
145 Ga0466703_082097 3300042636 Bacteria 5778
146 Ga0466703_303354 3300042636 Bacteria 59593
147 Ga0466709_018196 3300042648 Bacteria 3175
148 Ga0466708_179840 3300042652 Bacteria 28624
149 Ga0466727_304784 3300042655 Bacteria 1478
150 Ga0466713_111815 3300042602 Bacteria 2006
151 Ga0466719_551588 3300042606 Bacteria 4285
152 Ga0466722_175883 3300042609 Bacteria 14011
153 Ga0466722_265120 3300042609 Bacteria 1877
154 Ga0466712_129327 3300042614 Bacteria 10746
155 Ga0466712_181455 3300042614 Bacteria 1620
156 Ga0466715_498820 3300042616 Bacteria 3051
157 Ga0466718_155848 3300042617 Bacteria 7172
158 Ga0466723_183954 3300042618 Bacteria 6652
159 Ga0466723_272050 3300042618 Bacteria 5619
160 Ga0466726_406595 3300042619 Bacteria 4700
161 Ga0466726_472068 3300042619 Bacteria 53187
162 Ga0123356_10110939 3300010049 Bacteria 2649
163 Ga0123354_10224437 3300010882 Bacteria 1985
164 Ga0466690_185048 3300042590 Unclassified 4877
165 Ga0466691_025653 3300042593 Bacteria 20181
166 JGI24698J34947_10016722 3300002449 Bacteria 3980
167 JGI24698J34947_10062540 3300002449 Unclassified 1827
168 Ga0466705_132894 3300042612 Bacteria 4259
169 Ga0466732_163532 3300042656 Unclassified 6808
170 Ga0466703_392235 3300042636 Bacteria 11647
171 Ga0466704_058707 3300042643 Unclassified 3426
172 Ga0466704_592366 3300042643 Bacteria 5767
173 Ga0466708_227779 3300042652 Unclassified 2152
174 Ga0466727_146685 3300042655 Bacteria 12131
175 Ga0466706_121773 3300042599 Bacteria 3656
176 Ga0466713_026543 3300042602 Bacteria 9552
177 Ga0466716_176265 3300042605 Bacteria 3644
178 Ga0466722_050071 3300042609 Bacteria 4570
179 Ga0466715_139098 3300042616 Bacteria 9207
180 Ga0466715_419993 3300042616 Bacteria 10202
181 Ga0466693_008000 3300042592 Bacteria 2086
182 Ga0466691_052677 3300042593 Bacteria 5931
183 AustNasuHG_c1003296 3300000089 Bacteria 5828
184 JGI24698J34947_10025604 3300002449 Unclassified 3140
185 Ga0074263_110646 3300005485 Bacteria 4448
186 Ga0466705_185102 3300042612 Bacteria 3641
187 Ga0466703_199972 3300042636 Bacteria 18432
188 Ga0466703_207923 3300042636 Bacteria 3355
189 Ga0466704_025066 3300042643 Unclassified 3411
190 Ga0466704_190609 3300042643 Bacteria 6367
191 Ga0466709_019248 3300042648 Bacteria 11979
192 Ga0466708_030637 3300042652 Bacteria 19599
193 Ga0466708_170781 3300042652 Bacteria 9680
194 Ga0466719_013057 3300042606 Bacteria 9078
195 Ga0466711_137470 3300042615 Bacteria 10732
196 Ga0466715_017244 3300042616 Bacteria 39122
197 Ga0466715_028200 3300042616 Bacteria 10144
198 Ga0466715_337385 3300042616 Bacteria 28368
199 Ga0466715_637404 3300042616 Bacteria 9383
200 Ga0466728_047521 3300042620 Bacteria 4098
201 Ga0466728_241715 3300042620 Bacteria 7273
202 Ga0466690_356187 3300042590 Bacteria 3336
203 Ga0466691_172561 3300042593 Bacteria 4430
204 Ga0466691_190195 3300042593 Bacteria 4286
205 Ga0466696_015539 3300042596 Bacteria 3722
206 AustNasuHG_c1011172 3300000089 Bacteria 3115
207 AustNasuHG_c1017164 3300000089 Bacteria 2411
208 Ga0466705_017521 3300042612 Bacteria 8187
209 Ga0466704_326271 3300042643 Bacteria 5313
210 Ga0466704_532138 3300042643 Bacteria 6381
211 Ga0466709_019570 3300042648 Bacteria 4591
212 Ga0466708_238777 3300042652 Bacteria 13415
213 Ga0466727_211287 3300042655 Bacteria 1523
214 Ga0466717_018769 3300042604 Bacteria 1745
215 Ga0466719_085722 3300042606 Bacteria 3004
216 Ga0466720_009018 3300042607 Unclassified 5797
217 Ga0466720_044787 3300042607 Unclassified 5999
218 Ga0466722_086274 3300042609 Bacteria 12697
219 Ga0466723_056281 3300042618 Bacteria 5284
220 Ga0466723_092072 3300042618 Bacteria 3161
221 Ga0466723_140445 3300042618 Bacteria 6484
222 Ga0466723_274141 3300042618 Bacteria 5672
223 Ga0466728_427592 3300042620 Unclassified 2596
224 Ga0466692_057609 3300042591 Bacteria 2518
225 Ga0466692_133640 3300042591 Bacteria 8995
226 Ga0466691_037286 3300042593 Bacteria 4656
227 Ga0466691_094938 3300042593 Bacteria 5668
228 Ga0466696_218438 3300042596 Bacteria 4907
229 Ga0466699_111547 3300042597 Unclassified 3125
230 Ga0466699_389560 3300042597 Bacteria 2576
231 Ga0068305_10001083 3300005083 Bacteria 23427
232 Ga0074263_108853 3300005485 Bacteria 2356

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042609 Ga0466722_265120 Ga0466722_265120_22_1209 395
2 iso_pr_bacteria 2781125632 2781270773 424
3 3300042614 Ga0466712_181455 Ga0466712_181455_178_1470 430
4 3300042590 Ga0466690_005348 Ga0466690_005348_11340_12776 432
5 3300042596 Ga0466696_071528 Ga0466696_071528_6979_8415 432
6 3300042593 Ga0466691_011266 Ga0466691_011266_1657_2958 433
7 3300042597 Ga0466699_389560 Ga0466699_389560_49_1350 433
8 3300042616 Ga0466715_349603 Ga0466715_349603_4312_5613 433
9 3300042618 Ga0466723_272050 Ga0466723_272050_4140_5576 433
10 3300042656 Ga0466732_231735 Ga0466732_231735_79_1380 433
11 3300042596 Ga0466696_005818 Ga0466696_005818_1674_3107 437
12 3300042612 Ga0466705_086245 Ga0466705_086245_31_1347 438
13 3300042605 Ga0466716_201290 Ga0466716_201290_2156_3592 439
14 3300042616 Ga0466715_419993 Ga0466715_419993_4122_5558 442
15 3300042652 Ga0466708_179840 Ga0466708_179840_8987_10423 443
16 3300042618 Ga0466723_056281 Ga0466723_056281_2678_4114 445
17 3300042616 Ga0466715_408251 Ga0466715_408251_3381_4817 448
18 3300042606 Ga0466719_085722 Ga0466719_085722_1530_2966 453
19 3300042620 Ga0466728_241715 Ga0466728_241715_548_1984 454
20 3300042616 Ga0466715_329218 Ga0466715_329218_3875_5314 460
21 3300042591 Ga0466692_061217 Ga0466692_061217_24865_26301 461
22 3300042616 Ga0466715_334917 Ga0466715_334917_5150_6586 461
23 3300042618 Ga0466723_183954 Ga0466723_183954_4900_6336 461
24 3300042612 Ga0466705_057988 Ga0466705_057988_1266_2699 467
25 3300005083 Ga0068305_10032411 Ga0068305_100324115 470
26 3300042596 Ga0466696_288965 Ga0466696_288965_632_2068 470
27 3300042615 Ga0466711_137470 Ga0466711_137470_8500_9936 470
28 3300042612 Ga0466705_017521 Ga0466705_017521_478_1911 477
29 3300042612 Ga0466705_104460 Ga0466705_104460_222_1655 477
30 3300042615 Ga0466711_048011 Ga0466711_048011_6186_7619 477
31 3300042643 Ga0466704_254801 Ga0466704_254801_1965_3398 477
32 3300038395 Ga0415639_011024 Ga0415639_011024_1342_2778 478
33 3300041968 Ga0456237_0001572 Ga0456237_0001572_772_2208 478
34 3300041968 Ga0456237_0002972 Ga0456237_0002972_39_1475 478
35 3300042590 Ga0466690_182665 Ga0466690_182665_6134_7570 478
36 3300042590 Ga0466690_185048 Ga0466690_185048_634_2070 478
37 3300042590 Ga0466690_253353 Ga0466690_253353_2024_3460 478
38 3300042590 Ga0466690_270102 Ga0466690_270102_7819_9255 478
39 3300042590 Ga0466690_286042 Ga0466690_286042_2216_3652 478
40 3300042591 Ga0466692_011152 Ga0466692_011152_4886_6322 478
41 3300042591 Ga0466692_122932 Ga0466692_122932_7824_9260 478
42 3300042591 Ga0466692_133640 Ga0466692_133640_2687_4123 478
43 3300042592 Ga0466693_008000 Ga0466693_008000_37_1473 478
44 3300042593 Ga0466691_025653 Ga0466691_025653_2781_4217 478
45 3300042593 Ga0466691_037286 Ga0466691_037286_1682_3118 478
46 3300042593 Ga0466691_049961 Ga0466691_049961_1667_3103 478
47 3300042593 Ga0466691_073031 Ga0466691_073031_46_1482 478
48 3300042593 Ga0466691_094938 Ga0466691_094938_1943_3379 478
49 3300042593 Ga0466691_095697 Ga0466691_095697_563_1999 478
50 3300042593 Ga0466691_105805 Ga0466691_105805_6324_7760 478
51 3300042593 Ga0466691_105957 Ga0466691_105957_123_1559 478
52 3300042593 Ga0466691_128234 Ga0466691_128234_2502_3938 478
53 3300042593 Ga0466691_147028 Ga0466691_147028_3960_5396 478
54 3300042593 Ga0466691_172561 Ga0466691_172561_1702_3138 478
55 3300042593 Ga0466691_190195 Ga0466691_190195_1712_3148 478
56 3300042596 Ga0466696_015539 Ga0466696_015539_1724_3160 478
57 3300042596 Ga0466696_017879 Ga0466696_017879_7101_8537 478
58 3300042596 Ga0466696_023816 Ga0466696_023816_869_2305 478
59 3300042596 Ga0466696_097603 Ga0466696_097603_580_2016 478
60 3300042596 Ga0466696_218438 Ga0466696_218438_2477_3913 478
61 3300042596 Ga0466696_273947 Ga0466696_273947_13362_14798 478
62 3300042601 Ga0466707_189457 Ga0466707_189457_112_1548 478
63 3300042602 Ga0466713_026543 Ga0466713_026543_164_1600 478
64 3300042604 Ga0466717_018769 Ga0466717_018769_190_1626 478
65 3300042605 Ga0466716_001631 Ga0466716_001631_1725_3161 478
66 3300042605 Ga0466716_092401 Ga0466716_092401_1304_2740 478
67 3300042605 Ga0466716_176265 Ga0466716_176265_278_1714 478
68 3300042605 Ga0466716_254094 Ga0466716_254094_2453_3889 478
69 3300042606 Ga0466719_059752 Ga0466719_059752_10174_11610 478
70 3300042606 Ga0466719_126290 Ga0466719_126290_1987_3423 478
71 3300042606 Ga0466719_128679 Ga0466719_128679_2177_3613 478
72 3300042606 Ga0466719_187827 Ga0466719_187827_1906_3342 478
73 3300042606 Ga0466719_191445 Ga0466719_191445_176_1612 478
74 3300042606 Ga0466719_491825 Ga0466719_491825_933_2369 478
75 3300042606 Ga0466719_551588 Ga0466719_551588_1788_3224 478
76 3300042607 Ga0466720_012390 Ga0466720_012390_1771_3207 478
77 3300042607 Ga0466720_053051 Ga0466720_053051_1858_3294 478
78 3300042607 Ga0466720_152963 Ga0466720_152963_1496_2932 478
79 3300042609 Ga0466722_036609 Ga0466722_036609_4338_5774 478
80 3300042609 Ga0466722_050071 Ga0466722_050071_934_2370 478
81 3300042609 Ga0466722_222964 Ga0466722_222964_8174_9610 478
82 3300042612 Ga0466705_011525 Ga0466705_011525_2462_3898 478
83 3300042612 Ga0466705_064073 Ga0466705_064073_2231_3667 478
84 3300042612 Ga0466705_093071 Ga0466705_093071_405_1841 478
85 3300042612 Ga0466705_132894 Ga0466705_132894_1587_3023 478
86 3300042612 Ga0466705_159269 Ga0466705_159269_1572_3008 478
87 3300042612 Ga0466705_260214 Ga0466705_260214_2815_4251 478
88 3300042612 Ga0466705_530508 Ga0466705_530508_1355_2791 478
89 3300042614 Ga0466712_049786 Ga0466712_049786_1601_3037 478
90 3300042614 Ga0466712_129327 Ga0466712_129327_9187_10623 478
91 3300042614 Ga0466712_151172 Ga0466712_151172_1462_2898 478
92 3300042614 Ga0466712_202636 Ga0466712_202636_6548_7984 478
93 3300042615 Ga0466711_028445 Ga0466711_028445_9407_10843 478
94 3300042615 Ga0466711_163973 Ga0466711_163973_590_2026 478
95 3300042616 Ga0466715_013386 Ga0466715_013386_1071_2507 478
96 3300042616 Ga0466715_017244 Ga0466715_017244_27189_28625 478
97 3300042616 Ga0466715_028200 Ga0466715_028200_5227_6663 478
98 3300042616 Ga0466715_059331 Ga0466715_059331_7239_8675 478
99 3300042616 Ga0466715_139098 Ga0466715_139098_3815_5251 478
100 3300042616 Ga0466715_337385 Ga0466715_337385_25682_27118 478
101 3300042616 Ga0466715_643978 Ga0466715_643978_843_2279 478
102 3300042618 Ga0466723_022695 Ga0466723_022695_1791_3227 478
103 3300042618 Ga0466723_036199 Ga0466723_036199_5532_6968 478
104 3300042618 Ga0466723_092072 Ga0466723_092072_993_2429 478
105 3300042618 Ga0466723_140445 Ga0466723_140445_4876_6312 478
106 3300042618 Ga0466723_159008 Ga0466723_159008_4603_6039 478
107 3300042618 Ga0466723_333951 Ga0466723_333951_8776_10212 478
108 3300042619 Ga0466726_100680 Ga0466726_100680_1773_3209 478
109 3300042619 Ga0466726_164932 Ga0466726_164932_91_1527 478
110 3300042619 Ga0466726_406595 Ga0466726_406595_979_2415 478
111 3300042620 Ga0466728_012178 Ga0466728_012178_706_2142 478
112 3300042620 Ga0466728_195879 Ga0466728_195879_1588_3024 478
113 3300042621 Ga0466729_084385 Ga0466729_084385_967_2403 478
114 3300042636 Ga0466703_005691 Ga0466703_005691_295_1731 478
115 3300042636 Ga0466703_082097 Ga0466703_082097_1624_3060 478
116 3300042636 Ga0466703_175340 Ga0466703_175340_20_1456 478
117 3300042636 Ga0466703_199972 Ga0466703_199972_1710_3146 478
118 3300042636 Ga0466703_207923 Ga0466703_207923_1145_2581 478
119 3300042636 Ga0466703_272773 Ga0466703_272773_1074_2510 478
120 3300042636 Ga0466703_358780 Ga0466703_358780_135_1571 478
121 3300042636 Ga0466703_392235 Ga0466703_392235_2060_3496 478
122 3300042643 Ga0466704_025066 Ga0466704_025066_631_2067 478
123 3300042643 Ga0466704_058707 Ga0466704_058707_167_1603 478
124 3300042643 Ga0466704_140159 Ga0466704_140159_932_2368 478
125 3300042643 Ga0466704_190609 Ga0466704_190609_1669_3105 478
126 3300042643 Ga0466704_312082 Ga0466704_312082_1382_2818 478
127 3300042643 Ga0466704_532138 Ga0466704_532138_3014_4450 478
128 3300042643 Ga0466704_592366 Ga0466704_592366_4001_5437 478
129 3300042648 Ga0466709_018196 Ga0466709_018196_66_1502 478
130 3300042648 Ga0466709_019248 Ga0466709_019248_1133_2569 478
131 3300042648 Ga0466709_074784 Ga0466709_074784_3228_4664 478
132 3300042648 Ga0466709_160100 Ga0466709_160100_5020_6456 478
133 3300042648 Ga0466709_297537 Ga0466709_297537_17168_18604 478
134 3300042648 Ga0466709_416037 Ga0466709_416037_144_1580 478
135 3300042652 Ga0466708_030637 Ga0466708_030637_6011_7447 478
136 3300042652 Ga0466708_040230 Ga0466708_040230_30_1466 478
137 3300042652 Ga0466708_127532 Ga0466708_127532_4371_5807 478
138 3300042652 Ga0466708_170781 Ga0466708_170781_4982_6418 478
139 3300042652 Ga0466708_227779 Ga0466708_227779_30_1466 478
140 3300042652 Ga0466708_238777 Ga0466708_238777_10946_12382 478
141 3300042652 Ga0466708_285658 Ga0466708_285658_36420_37856 478
142 3300042652 Ga0466708_303986 Ga0466708_303986_6999_8435 478
143 3300042652 Ga0466708_348891 Ga0466708_348891_939_2375 478
144 3300042655 Ga0466727_114339 Ga0466727_114339_618_2054 478
145 3300042655 Ga0466727_146685 Ga0466727_146685_6716_8152 478
146 3300042655 Ga0466727_147857 Ga0466727_147857_1220_2656 478
147 3300042655 Ga0466727_304784 Ga0466727_304784_24_1460 478
148 iso_pr_bacteria 2772190975 2773724630 478
149 iso_pr_bacteria 2781125634 2781274078 478
150 iso_pr_bacteria 2781125697 2781442860 478
151 iso_pr_bacteria 650716099 650877961 478
152 iso_pr_bacteria 650716102 650880794 478
153 3300000089 AustNasuHG_c1011172 AustNasuHG_10111722 479
154 3300002449 JGI24698J34947_10016722 JGI24698J34947_100167222 479
155 3300002449 JGI24698J34947_10025604 JGI24698J34947_100256041 479
156 3300002449 JGI24698J34947_10062540 JGI24698J34947_100625402 479
157 3300002462 JGI24702J35022_10006689 JGI24702J35022_100066893 479
158 3300005485 Ga0074263_108853 Ga0074263_1088532 479
159 3300005485 Ga0074263_110646 Ga0074263_1106464 479
160 3300010167 Ga0123353_10148960 Ga0123353_101489603 479
161 3300010167 Ga0123353_10205569 Ga0123353_102055691 479
162 3300010167 Ga0123353_10441554 Ga0123353_104415542 479
163 3300010882 Ga0123354_10224437 Ga0123354_102244371 479
164 3300042590 Ga0466690_356187 Ga0466690_356187_867_2306 479
165 3300042591 Ga0466692_057609 Ga0466692_057609_527_1966 479
166 3300042596 Ga0466696_298009 Ga0466696_298009_1855_3294 479
167 3300042597 Ga0466699_016990 Ga0466699_016990_5223_6662 479
168 3300042597 Ga0466699_111547 Ga0466699_111547_919_2358 479
169 3300042602 Ga0466713_111815 Ga0466713_111815_62_1501 479
170 3300042606 Ga0466719_013057 Ga0466719_013057_2482_3921 479
171 3300042606 Ga0466719_070963 Ga0466719_070963_5493_6932 479
172 3300042609 Ga0466722_086274 Ga0466722_086274_854_2293 479
173 3300042609 Ga0466722_175883 Ga0466722_175883_2006_3445 479
174 3300042609 Ga0466722_187158 Ga0466722_187158_4613_6052 479
175 3300042609 Ga0466722_223987 Ga0466722_223987_2161_3600 479
176 3300042612 Ga0466705_185102 Ga0466705_185102_264_1703 479
177 3300042615 Ga0466711_076850 Ga0466711_076850_16787_18226 479
178 3300042615 Ga0466711_364950 Ga0466711_364950_5529_6968 479
179 3300042616 Ga0466715_075991 Ga0466715_075991_10678_12117 479
180 3300042616 Ga0466715_498542 Ga0466715_498542_971_2410 479
181 3300042616 Ga0466715_498820 Ga0466715_498820_916_2355 479
182 3300042618 Ga0466723_274141 Ga0466723_274141_838_2277 479
183 3300042620 Ga0466728_047521 Ga0466728_047521_1694_3133 479
184 3300042636 Ga0466703_037865 Ga0466703_037865_1342_2781 479
185 3300042643 Ga0466704_220972 Ga0466704_220972_817_2256 479
186 3300042643 Ga0466704_326271 Ga0466704_326271_1820_3259 479
187 3300042655 Ga0466727_211287 Ga0466727_211287_18_1457 479
188 iso_pr_bacteria 2781125655 2781319033 479
189 3300009826 Ga0123355_10016969 Ga0123355_100169693 480
190 3300042593 Ga0466691_052677 Ga0466691_052677_4403_5845 480
191 3300042609 Ga0466722_154505 Ga0466722_154505_338_1780 480
192 3300042616 Ga0466715_037085 Ga0466715_037085_1459_2901 480
193 3300042616 Ga0466715_637404 Ga0466715_637404_5108_6550 480
194 3300042617 Ga0466718_022413 Ga0466718_022413_6328_7770 480
195 3300042618 Ga0466723_124226 Ga0466723_124226_254_1696 480
196 3300042618 Ga0466723_310211 Ga0466723_310211_5490_6932 480
197 3300042620 Ga0466728_427592 Ga0466728_427592_950_2392 480
198 3300042624 Ga0466735_098886 Ga0466735_098886_2008_3450 480
199 3300042636 Ga0466703_303354 Ga0466703_303354_55710_57152 480
200 3300042643 Ga0466704_457484 Ga0466704_457484_14690_16132 480
201 3300042648 Ga0466709_392983 Ga0466709_392983_1500_2942 480
202 3300042652 Ga0466708_160968 Ga0466708_160968_722_2164 480
203 iso_pr_bacteria 2819994798 2819996512 480
204 3300042605 Ga0466716_339591 Ga0466716_339591_3649_5094 481
205 3300042606 Ga0466719_044531 Ga0466719_044531_3407_4852 481
206 3300042609 Ga0466722_191869 Ga0466722_191869_2058_3503 481
207 3300042619 Ga0466726_177957 Ga0466726_177957_10764_12209 481
208 3300042636 Ga0466703_224292 Ga0466703_224292_4813_6258 481
209 3300042652 Ga0466708_286264 Ga0466708_286264_81092_82537 481
210 3300042596 Ga0466696_352716 Ga0466696_352716_38190_39638 482
211 3300042599 Ga0466706_121773 Ga0466706_121773_88_1536 482
212 3300042618 Ga0466723_092273 Ga0466723_092273_651_2099 482
213 3300042619 Ga0466726_472068 Ga0466726_472068_42469_43917 482
214 3300042652 Ga0466708_151255 Ga0466708_151255_3804_5252 482
215 3300042659 Ga0466733_087939 Ga0466733_087939_2345_3793 482
216 3300005083 Ga0068305_10001083 Ga0068305_1000108314 483
217 3300010049 Ga0123356_10110939 Ga0123356_101109391 483
218 3300042607 Ga0466720_044345 Ga0466720_044345_1328_2779 483
219 3300042607 Ga0466720_044787 Ga0466720_044787_923_2374 483
220 3300042656 Ga0466732_163532 Ga0466732_163532_3633_5084 483
221 3300042659 Ga0466733_106142 Ga0466733_106142_5037_6488 483
222 3300000089 AustNasuHG_c1000930 AustNasuHG_100093011 484
223 3300002508 JGI24700J35501_10930330 JGI24700J35501_1093033011 484
224 3300010049 Ga0123356_10040224 Ga0123356_100402244 484
225 3300042615 Ga0466711_294734 Ga0466711_294734_4439_5893 484
226 3300042619 Ga0466726_187217 Ga0466726_187217_1463_2917 484
227 3300042609 Ga0466722_243957 Ga0466722_243957_332_1789 485
228 3300042636 Ga0466703_028972 Ga0466703_028972_2904_4367 487
229 3300042655 Ga0466727_077429 Ga0466727_077429_296_1759 487
230 3300042592 Ga0466693_353122 Ga0466693_353122_82_1548 488
231 3300042607 Ga0466720_009018 Ga0466720_009018_3270_4736 488
232 3300042607 Ga0466720_020932 Ga0466720_020932_3813_5279 488
233 3300042607 Ga0466720_209844 Ga0466720_209844_200_1666 488
234 3300042617 Ga0466718_031913 Ga0466718_031913_7720_9186 488
235 3300042617 Ga0466718_139620 Ga0466718_139620_464_1930 488
236 3300042617 Ga0466718_155848 Ga0466718_155848_1329_2795 488
237 3300042618 Ga0466723_263331 Ga0466723_263331_4123_5598 491
238 3300042648 Ga0466709_019570 Ga0466709_019570_2132_3610 492
239 3300000089 AustNasuHG_c1017164 AustNasuHG_10171642 500
240 3300000089 AustNasuHG_c1003296 AustNasuHG_10032964 514

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00571 CBS CBS domain 146 196 0.97
PF00478 IMPDH IMP dehydrogenase / GMP reductase domain 5 447 0.96
PF01070 FMN_dh FMN-dependent dehydrogenase 229 340 0.83
PF03060 NMO Nitronate monooxygenase 207 351 0.76

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00478 GO:0003824 catalytic activity MF
PF01070 GO:0016491 oxidoreductase activity MF
PF03060 GO:0018580 nitronate monooxygenase activity MF

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.79 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.