Protein Family IF08076

Metagenome Isolate
127 Members
44 Samples
116 Scaffolds
438.3 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_128569|Ga0466723_128569_21114_22535
Length
473 aa
Sequence
MPYQQQEKYMKSILILSQQIMGDKMKDKEKGILQRLVSGVDRLLIFVVVLIITVGIFAIYSATTNSGTSSKYLSIQFLALGIGIIGMLVLTVFNYQYYKQFDKTVYILSILLLISVLIFGSEIRGTKGWFKFGFASFQPVEIAKLMFILTLSSFLDRRWKDAKKPLIFIGAFLILMGHLSLIMMQPDFSSTLSYLPVTLVLLYLIGIEPFYLLCIIIFGALAIGIPLVNTFLKLQPVLEQNASFGGNFLSLIYEGHTGIYLVVAAVSLTFFAWWLMWKLRMRVSILYPVLITCSITFGSLASIPVEKSLKEYQRKRLVVFLNPSADPRGAGYNIIQSKIAIGSGKLLGKGFIKGTQTQLGFLPEQHTDFIFSVIGEEGGWVISQLTILFYLFFIWRALVISVEARDRYGSLVSAGLATMFAFYAIINIGMVMGIMPATGVPLVLMSYGGSSMVSSLLGVGILQSIHMRRHTYY

📊 Sample Types

Isolate 8.7%
Metagenome 91.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 31.8%
Kalotermitidae 31.8%
Termitidae 20.5%
Termopsidae 9.1%
Rhinotermitidae 4.5%
Hodotermitidae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 119
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
2 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
3 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
4 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
5 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
6 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
7 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
8 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
9 2778260940 Unclassified Fibrobacteres Mp193P3bin36 Isolate Unclassified
10 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
11 642555172 Endomicrobium trichonymphae Rs-D17 Isolate Unclassified
12 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
13 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
14 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
15 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
16 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
17 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
18 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
19 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
20 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
21 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
22 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 2772190889 Unclassified Elusimicrobia Cu122P5_bin43 Isolate Unclassified
25 2820721785 Unclassified Fibrobacteres Lab288P1bin58 Isolate Unclassified
26 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
27 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
28 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
29 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
30 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
31 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
32 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
33 2772190893 Unclassified Elusimicrobia Nt197P4_bin29 Isolate Unclassified
34 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
35 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
36 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
37 2772190891 Unclassified Elusimicrobia Emb289P1_bin41 Isolate Unclassified
38 2772190895 Unclassified Elusimicrobia Emb289P1_bin39 Isolate Unclassified
39 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
40 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
41 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
42 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
43 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
44 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466690_369118 3300042590 Bacteria 28017
2 Ga0466711_134125 3300042615 Bacteria 100014
3 Ga0466723_180228 3300042618 Bacteria 22722
4 Ga0466726_208743 3300042619 Bacteria 3537
5 Ga0466728_355312 3300042620 Bacteria 41370
6 Ga0466706_037575 3300042599 Bacteria 87054
7 Ga0466706_093897 3300042599 Bacteria 41180
8 Ga0466707_063131 3300042601 Bacteria 29958
9 Ga0466713_104587 3300042602 Bacteria 60209
10 Ga0466714_135782 3300042603 Bacteria 52371
11 Ga0466719_172731 3300042606 Bacteria 15347
12 Ga0466727_059455 3300042655 Bacteria 175715
13 Ga0466705_208486 3300042612 Bacteria 71494
14 Ga0466705_211457 3300042612 Bacteria 22546
15 Ga0466690_029087 3300042590 Bacteria 68822
16 Ga0466690_173505 3300042590 Bacteria 8988
17 Ga0466691_065678 3300042593 Unclassified 5133
18 Ga0466696_189295 3300042596 Unclassified 22793
19 Ga0466715_158630 3300042616 Bacteria 22211
20 Ga0466715_292561 3300042616 Bacteria 14999
21 Ga0466715_447962 3300042616 Unclassified 11377
22 Ga0466723_055375 3300042618 Bacteria 3566
23 Ga0466723_091919 3300042618 Bacteria 27263
24 Ga0466728_411352 3300042620 Bacteria 26274
25 Ga0466729_129641 3300042621 Bacteria 24606
26 Ga0466706_217033 3300042599 Bacteria 132615
27 Ga0466707_067647 3300042601 Bacteria 4837
28 Ga0466707_308526 3300042601 Bacteria 6849
29 Ga0466707_315151 3300042601 Bacteria 79442
30 Ga0466716_400985 3300042605 Bacteria 5353
31 Ga0466719_040967 3300042606 Bacteria 2782
32 Ga0466735_059484 3300042624 Bacteria 12495
33 Ga0466735_201938 3300042624 Bacteria 5700
34 Ga0466703_220297 3300042636 Bacteria 23837
35 Ga0466727_110661 3300042655 Bacteria 4217
36 Ga0466727_225876 3300042655 Bacteria 3121
37 Ga0068305_10000079 3300005083 Bacteria 163717
38 Ga0466691_226264 3300042593 Bacteria 41880
39 Ga0466712_181605 3300042614 Bacteria 3795
40 Ga0466711_372501 3300042615 Bacteria 489210
41 Ga0466711_376431 3300042615 Bacteria 48940
42 Ga0466715_046636 3300042616 Bacteria 70768
43 Ga0466715_335506 3300042616 Bacteria 2953
44 Ga0466726_428214 3300042619 Bacteria 5500
45 Ga0466728_011302 3300042620 Bacteria 42378
46 Ga0466707_229920 3300042601 Bacteria 5638
47 Ga0466713_092327 3300042602 Bacteria 48279
48 Ga0466729_268858 3300042621 Bacteria 59050
49 Ga0466735_049520 3300042624 Bacteria 3765
50 Ga0466704_379821 3300042643 Bacteria 15704
51 Ga0466704_591830 3300042643 Bacteria 37928
52 Ga0466727_322139 3300042655 Bacteria 101886
53 Ga0466690_394362 3300042590 Bacteria 1791
54 Ga0466690_434338 3300042590 Bacteria 3842
55 Ga0466723_325001 3300042618 Bacteria 3917
56 Ga0466707_197862 3300042601 Bacteria 9479
57 Ga0466719_126414 3300042606 Bacteria 59815
58 Ga0466735_001420 3300042624 Bacteria 8899
59 Ga0466735_044886 3300042624 Bacteria 7691
60 Ga0466703_007133 3300042636 Bacteria 3470
61 Ga0466704_177682 3300042643 Bacteria 28567
62 JGI24698J34947_10000648 3300002449 Unclassified 16836
63 Ga0466726_172880 3300042619 Bacteria 24710
64 Ga0466729_035403 3300042621 Bacteria 3991
65 Ga0466729_038350 3300042621 Bacteria 15638
66 Ga0466729_154929 3300042621 Bacteria 7863
67 Ga0466706_016612 3300042599 Bacteria 25546
68 Ga0466706_166478 3300042599 Bacteria 103376
69 Ga0466704_375586 3300042643 Bacteria 37503
70 Ga0466727_214209 3300042655 Bacteria 66628
71 JGI24705J35276_12238808 3300002504 Bacteria 121301
72 Ga0068305_10001840 3300005083 Bacteria 12768
73 Ga0466690_127221 3300042590 Unclassified 4022
74 Ga0466690_230957 3300042590 Bacteria 25729
75 Ga0466715_436492 3300042616 Bacteria 169505
76 Ga0466723_195741 3300042618 Bacteria 6670
77 Ga0123357_10022015 3300009784 Bacteria 8540
78 Ga0466716_454581 3300042605 Bacteria 19893
79 Ga0466703_094842 3300042636 Bacteria 32537
80 Ga0466727_271147 3300042655 Bacteria 176023
81 Ga0068305_10001287 3300005083 Bacteria 40663
82 Ga0068305_10001382 3300005083 Bacteria 35132
83 Ga0068305_10005361 3300005083 Bacteria 24001
84 Ga0466690_129789 3300042590 Bacteria 30239
85 Ga0466694_351984 3300042594 Bacteria 2960
86 Ga0466696_029290 3300042596 Bacteria 39093
87 Ga0466711_400964 3300042615 Bacteria 5228
88 Ga0466715_228690 3300042616 Bacteria 3891
89 Ga0466726_077377 3300042619 Bacteria 33283
90 Ga0466726_317531 3300042619 Bacteria 2068
91 Ga0466728_151666 3300042620 Bacteria 23701
92 Ga0123355_10165101 3300009826 Bacteria 3325
93 Ga0123353_10000666 3300010167 Bacteria 41976
94 Ga0466706_144566 3300042599 Bacteria 12471
95 Ga0466716_126380 3300042605 Bacteria 28858
96 Ga0466716_213939 3300042605 Bacteria 5125
97 Ga0466703_110964 3300042636 Bacteria 165564
98 Ga0466709_030872 3300042648 Unclassified 64105
99 Ga0466708_279490 3300042652 Bacteria 27725
100 Ga0466727_170785 3300042655 Bacteria 1806
101 JGI24702J35022_10002376 3300002462 Bacteria 11512
102 Ga0068302_10014040 3300005071 Unclassified 3529
103 Ga0466705_029401 3300042612 Bacteria 1939
104 Ga0466715_256894 3300042616 Bacteria 26066
105 Ga0466723_128569 3300042618 Bacteria 22727
106 Ga0466726_303540 3300042619 Bacteria 65545
107 Ga0466726_387678 3300042619 Bacteria 397429
108 Ga0123357_10008439 3300009784 Bacteria 12865
109 Ga0123355_10004968 3300009826 Bacteria 19362
110 Ga0466713_059453 3300042602 Bacteria 25190
111 Ga0466719_130653 3300042606 Bacteria 158630
112 Ga0466719_148583 3300042606 Bacteria 2322
113 Ga0466722_155384 3300042609 Bacteria 6710
114 Ga0466735_201674 3300042624 Bacteria 26620
115 Ga0466704_174075 3300042643 Unclassified 5444
116 Ga0466704_375208 3300042643 Bacteria 49491

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042615 Ga0466711_376431 Ga0466711_376431_21243_22421 392
2 3300042599 Ga0466706_144566 Ga0466706_144566_1178_2494 393
3 3300042606 Ga0466719_130653 Ga0466719_130653_21450_22670 398
4 3300042616 Ga0466715_046636 Ga0466715_046636_21177_22523 400
5 3300042606 Ga0466719_126414 Ga0466719_126414_34931_36229 403
6 3300042621 Ga0466729_268858 Ga0466729_268858_13263_14609 405
7 3300042590 Ga0466690_394362 Ga0466690_394362_220_1566 406
8 3300042603 Ga0466714_135782 Ga0466714_135782_32356_33705 409
9 3300002504 JGI24705J35276_12238808 JGI24705J35276_1223880836 413
10 3300042643 Ga0466704_177682 Ga0466704_177682_21842_23188 413
11 3300042590 Ga0466690_434338 Ga0466690_434338_805_2151 414
12 3300042596 Ga0466696_029290 Ga0466696_029290_14769_16121 415
13 3300042599 Ga0466706_037575 Ga0466706_037575_27017_28303 415
14 3300042643 Ga0466704_379821 Ga0466704_379821_2639_3985 416
15 3300042599 Ga0466706_217033 Ga0466706_217033_97426_98751 418
16 3300042602 Ga0466713_092327 Ga0466713_092327_21430_22776 418
17 3300005083 Ga0068305_10001287 Ga0068305_1000128735 419
18 3300042616 Ga0466715_158630 Ga0466715_158630_20680_22026 423
19 3300042618 Ga0466723_180228 Ga0466723_180228_20672_22018 423
20 3300042655 Ga0466727_322139 Ga0466727_322139_21554_22906 423
21 3300042590 Ga0466690_029087 Ga0466690_029087_20961_22310 424
22 3300042619 Ga0466726_387678 Ga0466726_387678_36454_37728 424
23 3300042612 Ga0466705_029401 Ga0466705_029401_202_1551 425
24 3300042618 Ga0466723_055375 Ga0466723_055375_643_1992 425
25 3300005071 Ga0068302_10014040 Ga0068302_100140402 426
26 3300042605 Ga0466716_454581 Ga0466716_454581_2854_4209 426
27 3300042620 Ga0466728_355312 Ga0466728_355312_18993_20339 427
28 3300042615 Ga0466711_372501 Ga0466711_372501_21079_22428 428
29 3300042616 Ga0466715_292561 Ga0466715_292561_10407_11753 428
30 3300042594 Ga0466694_351984 Ga0466694_351984_881_2194 429
31 3300042619 Ga0466726_172880 Ga0466726_172880_22746_24092 429
32 3300042621 Ga0466729_154929 Ga0466729_154929_3199_4545 429
33 3300002462 JGI24702J35022_10002376 JGI24702J35022_100023764 430
34 3300010167 Ga0123353_10000666 Ga0123353_1000066637 430
35 3300042599 Ga0466706_166478 Ga0466706_166478_68095_69420 430
36 3300042619 Ga0466726_077377 Ga0466726_077377_22679_24025 430
37 3300042619 Ga0466726_317531 Ga0466726_317531_609_1958 430
38 3300042616 Ga0466715_447962 Ga0466715_447962_1025_2371 432
39 3300042619 Ga0466726_303540 Ga0466726_303540_21844_23193 432
40 3300042636 Ga0466703_110964 Ga0466703_110964_21326_22678 432
41 3300005083 Ga0068305_10005361 Ga0068305_1000536133 433
42 3300042620 Ga0466728_151666 Ga0466728_151666_21012_22358 433
43 3300009784 Ga0123357_10022015 Ga0123357_100220154 434
44 3300042619 Ga0466726_428214 Ga0466726_428214_1059_2408 434
45 3300005083 Ga0068305_10001382 Ga0068305_1000138224 435
46 3300042619 Ga0466726_208743 Ga0466726_208743_615_1964 435
47 3300042590 Ga0466690_230957 Ga0466690_230957_2245_3594 436
48 3300009826 Ga0123355_10165101 Ga0123355_101651012 437
49 3300042601 Ga0466707_229920 Ga0466707_229920_1125_2471 438
50 3300042618 Ga0466723_195741 Ga0466723_195741_126_1475 438
51 3300042648 Ga0466709_030872 Ga0466709_030872_47029_48375 439
52 3300042601 Ga0466707_067647 Ga0466707_067647_2360_3706 440
53 3300042621 Ga0466729_035403 Ga0466729_035403_1283_2632 440
54 3300042599 Ga0466706_093897 Ga0466706_093897_31678_33036 441
55 3300042602 Ga0466713_059453 Ga0466713_059453_22676_24001 441
56 3300005083 Ga0068305_10001840 Ga0068305_1000184013 442
57 3300042609 Ga0466722_155384 Ga0466722_155384_3215_4579 442
58 3300042615 Ga0466711_400964 Ga0466711_400964_2288_3634 442
59 3300042643 Ga0466704_375208 Ga0466704_375208_27059_28408 442
60 3300042606 Ga0466719_040967 Ga0466719_040967_1278_2627 443
61 3300042624 Ga0466735_044886 Ga0466735_044886_4139_5476 445
62 3300042643 Ga0466704_375586 Ga0466704_375586_15143_16483 446
63 iso_pr_bacteria 2820721785 2820723993 446
64 3300042636 Ga0466703_007133 Ga0466703_007133_2100_3443 447
65 3300042655 Ga0466727_059455 Ga0466727_059455_152629_154005 447
66 3300042590 Ga0466690_127221 Ga0466690_127221_511_1857 448
67 3300042590 Ga0466690_129789 Ga0466690_129789_23807_25153 448
68 3300042590 Ga0466690_173505 Ga0466690_173505_7625_8971 448
69 3300042593 Ga0466691_065678 Ga0466691_065678_2121_3467 448
70 3300042593 Ga0466691_226264 Ga0466691_226264_21067_22413 448
71 3300042596 Ga0466696_189295 Ga0466696_189295_21301_22647 448
72 3300042601 Ga0466707_063131 Ga0466707_063131_23966_25312 448
73 3300042601 Ga0466707_197862 Ga0466707_197862_7118_8464 448
74 3300042601 Ga0466707_315151 Ga0466707_315151_23604_24950 448
75 3300042602 Ga0466713_104587 Ga0466713_104587_20997_22343 448
76 3300042605 Ga0466716_400985 Ga0466716_400985_3393_4739 448
77 3300042606 Ga0466719_148583 Ga0466719_148583_718_2064 448
78 3300042615 Ga0466711_134125 Ga0466711_134125_21173_22519 448
79 3300042616 Ga0466715_256894 Ga0466715_256894_23994_25340 448
80 3300042616 Ga0466715_335506 Ga0466715_335506_838_2184 448
81 3300042616 Ga0466715_436492 Ga0466715_436492_21269_22615 448
82 3300042618 Ga0466723_091919 Ga0466723_091919_18371_19717 448
83 3300042618 Ga0466723_325001 Ga0466723_325001_642_1988 448
84 3300042620 Ga0466728_411352 Ga0466728_411352_21225_22571 448
85 3300042621 Ga0466729_038350 Ga0466729_038350_12047_13393 448
86 3300042624 Ga0466735_001420 Ga0466735_001420_3076_4422 448
87 3300042624 Ga0466735_049520 Ga0466735_049520_2206_3552 448
88 3300042624 Ga0466735_059484 Ga0466735_059484_9857_11203 448
89 3300042624 Ga0466735_201938 Ga0466735_201938_2143_3489 448
90 3300042636 Ga0466703_094842 Ga0466703_094842_21589_22935 448
91 3300042636 Ga0466703_220297 Ga0466703_220297_21301_22647 448
92 3300042643 Ga0466704_174075 Ga0466704_174075_117_1463 448
93 3300042643 Ga0466704_591830 Ga0466704_591830_869_2215 448
94 3300042652 Ga0466708_279490 Ga0466708_279490_6124_7470 448
95 3300042655 Ga0466727_110661 Ga0466727_110661_2583_3929 448
96 iso_pr_bacteria 642555172 642790883 448
97 3300005083 Ga0068305_10000079 Ga0068305_1000007944 449
98 3300042605 Ga0466716_213939 Ga0466716_213939_3391_4740 449
99 3300042612 Ga0466705_211457 Ga0466705_211457_20590_21939 449
100 3300042616 Ga0466715_228690 Ga0466715_228690_1699_3048 449
101 3300042624 Ga0466735_201674 Ga0466735_201674_14991_16340 449
102 3300042655 Ga0466727_170785 Ga0466727_170785_145_1494 449
103 3300042655 Ga0466727_214209 Ga0466727_214209_21418_22767 449
104 3300042655 Ga0466727_225876 Ga0466727_225876_884_2233 449
105 3300042655 Ga0466727_271147 Ga0466727_271147_153323_154672 449
106 iso_pr_bacteria 2754412482 2755215215 449
107 iso_pr_bacteria 2754412483 2755216812 449
108 iso_pr_bacteria 2772190889 2773432281 449
109 iso_pr_bacteria 2772190891 2773434932 449
110 iso_pr_bacteria 2772190892 2773436135 449
111 iso_pr_bacteria 2772190893 2773438346 449
112 iso_pr_bacteria 2772190894 2773439990 449
113 3300009784 Ga0123357_10008439 Ga0123357_1000843912 450
114 3300009826 Ga0123355_10004968 Ga0123355_1000496813 450
115 3300042599 Ga0466706_016612 Ga0466706_016612_21235_22587 450
116 3300042606 Ga0466719_172731 Ga0466719_172731_11997_13349 450
117 3300042590 Ga0466690_369118 Ga0466690_369118_24499_25854 451
118 3300042605 Ga0466716_126380 Ga0466716_126380_19517_20872 451
119 3300042612 Ga0466705_208486 Ga0466705_208486_20244_21599 451
120 3300042620 Ga0466728_011302 Ga0466728_011302_33487_34845 452
121 3300042601 Ga0466707_308526 Ga0466707_308526_2940_4301 453
122 3300042621 Ga0466729_129641 Ga0466729_129641_20172_21533 453
123 3300042614 Ga0466712_181605 Ga0466712_181605_160_1533 457
124 iso_pr_bacteria 2778260940 2778356351 457
125 3300002449 JGI24698J34947_10000648 JGI24698J34947_1000064817 458
126 iso_pr_bacteria 2772190895 2773440354 458
127 3300042618 Ga0466723_128569 Ga0466723_128569_21114_22535 473

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01098 FTSW_RODA_SPOVE Cell cycle protein 266 469 0.86

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.