Protein Family IF08068

Metagenome Isolate
202 Members
110 Samples
148 Scaffolds
272.38 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_116918|Ga0466723_116918_114_1070
Length
318 aa
Sequence
MWYTELSGAAPEFDRGRHDRKSYGITAPKTGRGGDGEVNMSILSGKKIGFIGAGRMAEAIFNGLLKSGKVSPKDLTVADIAGERLDELAAKYSVSVIKNAADGNAPLRGLLSCRVIVLAVKPQGANALLTEIGGWFTGDHLVVSIMGGITLGFLQNRIPGAAVIRVMPNLPILVGEGAAGVALGERASEDDGEVALAMFRAAGIAYLCPEHLLDPLTGVSGCGPAYAFLFIEAMADCGVEMGLPRDLAYRLAAQTLVGAGRMVLETGRHPGQLKDDVCSPGGSTIAGVHSLEQNGFRGIVMDAVEAAKLRMEEIGRDA

📊 Sample Types

Isolate 26.7%
Metagenome 73.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 29.6%
Termitidae 21.3%
Kalotermitidae 12.0%
Blattidae 5.6%
Drosophilidae 5.6%
Curculionidae 4.6%
Sarcophagidae 2.8%
Termopsidae 2.8%
Aphididae 1.9%
Culicidae 1.9%
Tenebrionidae 1.9%
Tephritidae 1.9%
Passalidae 1.9%
Apidae 1.9%
Thripidae 0.9%
Rhinotermitidae 0.9%
Hodotermitidae 0.9%
Anthocoridae 0.9%
Formicidae 0.9%

🌳 Taxonomy

Archaea 1
Bacteria 183
Eukaryota 1
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
2 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
3 2940349480 Fusobacterium sp. PH5-44 Isolate Blattidae
4 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
5 651324086 Plautia crossota stali symbiont Isolate Unclassified
6 8102982778 Erwinia sp. S63 Isolate Curculionidae
7 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
8 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
9 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
10 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
11 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
12 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
13 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
14 3300005322 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 1 gut Metagenome Drosophilidae
15 3300007506 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 3 gut Metagenome Drosophilidae
16 2645727860 Winslowiella iniecta B120 Isolate Aphididae
17 2651870110 Izhakiella capsodis N6PO6 Isolate Unclassified
18 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
19 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
20 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
21 2831380896 Ignatzschineria ureiclastica KCTC 22644 Isolate Sarcophagidae
22 2871771314 Pantoea sp. Ae16 Isolate Culicidae
23 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
24 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
25 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
26 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
27 648276708 Pantoea sp. aB Isolate Unclassified
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
30 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
31 2590828839 Clostridium sp. 1 Isolate Termitidae
32 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
33 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
34 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
35 2940241992 Fusobacterium sp. PH5-29 Isolate Blattidae
36 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
37 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
38 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
39 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
40 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
41 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
42 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
43 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
44 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
45 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
46 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
47 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
48 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
49 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
50 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
51 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
52 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
53 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
54 2898975184 Erwinia dacicola IL Isolate Tephritidae
55 8065340634 Ignatzschineria ureiclastica KCTC 22644 Isolate Sarcophagidae
56 8099192374 Erwinia typographi IC4 Isolate Curculionidae
57 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
58 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
59 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
60 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
61 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
62 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
63 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
64 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
65 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
66 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
67 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
68 2820647881 Unclassified Firmicutes Cu122P5bin16 Isolate Unclassified
69 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
70 650716102 Treponema primitia ZAS-2 Isolate Unclassified
71 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
72 3300007226 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 4 gut Metagenome Drosophilidae
73 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
74 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
75 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
76 2820371985 Unclassified Firmicutes Nt197P3bin100 Isolate Unclassified
77 2901296437 Erwinia dacicola Oroville Isolate Tephritidae
78 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
79 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
80 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
81 2513237114 Ignatzschineria larvae DSM 13226 Isolate Sarcophagidae
82 2585427711 Candidatus Schmidhempelia bombi Bimp Isolate Apidae
83 2593339125 Clostridium sp. 5 Isolate Termitidae
84 2648501209 Winslowiella iniecta B149 Isolate Aphididae
85 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
86 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
87 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
88 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
89 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
90 2820831444 Unclassified Actinobacteria Nc150P4bin21 Isolate Unclassified
91 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
92 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
93 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
94 3300005320 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 2 gut Metagenome Drosophilidae
95 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
96 2505679062 Candidatus Schmidhempelia bombi Bimp Isolate Apidae
97 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
98 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
99 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
100 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
101 8103002986 Erwinia sp. S38 Isolate Curculionidae
102 8103008710 Erwinia sp. S43 Isolate Curculionidae
103 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
104 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
105 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
106 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
107 3300007507 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut Metagenome Drosophilidae
108 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
109 3300009457 Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov Metagenome
110 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_322993 3300042612 Bacteria 4933
2 Ga0466715_578803 3300042616 Bacteria 3829
3 Ga0466706_039361 3300042599 Bacteria 37370
4 Ga0466707_202459 3300042601 Bacteria 205011
5 Ga0415639_044392 3300038395 Bacteria 1833
6 Ga0415639_084401 3300038395 Bacteria 1886
7 Ga0466699_249699 3300042597 Bacteria 1284
8 JGI24695J34938_10010628 3300002450 Bacteria 5023
9 JGI24695J34938_10013114 3300002450 Bacteria 4364
10 JGI24695J34938_10030010 3300002450 Bacteria 2537
11 Ga0074314_1146080 3300005322 Unclassified 2743
12 Ga0105008_1106204 3300007507 Unclassified 2286
13 Ga0466715_132867 3300042616 Bacteria 3916
14 Ga0466726_437260 3300042619 Bacteria 4489
15 Ga0466726_469675 3300042619 Bacteria 5104
16 Ga0466728_341464 3300042620 Bacteria 3612
17 Ga0466735_137926 3300042624 Bacteria 1094
18 Ga0466703_071041 3300042636 Bacteria 5019
19 Ga0466703_130543 3300042636 Bacteria 2477
20 Ga0466703_327607 3300042636 Bacteria 21356
21 Ga0466709_370938 3300042648 Bacteria 5921
22 Ga0466706_279036 3300042599 Bacteria 2987
23 Ga0466719_046990 3300042606 Bacteria 6447
24 Ga0456237_0016659 3300041968 Bacteria 1035
25 Ga0466696_465846 3300042596 Bacteria 6135
26 Ga0466699_156379 3300042597 Unclassified 1536
27 2227253017 2225789004 Bacteria 7106
28 IMNBL1DRAFT_c0000372 3300000062 Bacteria 38285
29 JGI24698J34947_10010590 3300002449 Bacteria 5061
30 JGI24698J34947_10026609 3300002449 Bacteria 3073
31 JGI24698J34947_10036992 3300002449 Bacteria 2538
32 JGI24695J34938_10000742 3300002450 Bacteria 30626
33 JGI24695J34938_10018892 3300002450 Archaea 3431
34 JGI24695J34938_10024106 3300002450 Unclassified 2925
35 Ga0063521_1000166 3300003973 Bacteria 49372
36 Ga0072941_1028944 3300005201 Bacteria 7323
37 Ga0105008_1097388 3300007507 Unclassified 4000
38 Ga0105008_1103156 3300007507 Unclassified 2753
39 Ga0127657_185103 3300009457 Bacteria 1705
40 Ga0466732_193136 3300042656 Bacteria 6223
41 Ga0562378_0469 3300056814 Bacteria 68128
42 Ga0123355_10455546 3300009826 Bacteria 1609
43 Ga0123354_10063095 3300010882 Unclassified 5448
44 Ga0466712_128693 3300042614 Bacteria 6619
45 Ga0466712_268511 3300042614 Bacteria 2073
46 Ga0466718_032487 3300042617 Bacteria 2935
47 Ga0466709_204823 3300042648 Bacteria 202980
48 Ga0466727_019591 3300042655 Bacteria 1564
49 Ga0466706_043928 3300042599 Bacteria 34859
50 Ga0466706_180766 3300042599 Bacteria 47789
51 Ga0466719_207405 3300042606 Bacteria 10265
52 Ga0466720_179107 3300042607 Bacteria 3441
53 JGI24698J34947_10004110 3300002449 Bacteria 7895
54 Ga0466705_368221 3300042612 Bacteria 1287
55 Ga0466732_039367 3300042656 Bacteria 13816
56 Ga0123353_10040180 3300010167 Bacteria 7378
57 Ga0123353_10503474 3300010167 Bacteria 1764
58 Ga0466718_056323 3300042617 Bacteria 3134
59 Ga0466723_182672 3300042618 Eukaryota 2214
60 Ga0466731_303959 3300042622 Bacteria 1047
61 Ga0466719_102351 3300042606 Bacteria 13783
62 Ga0316159_11863 3300030930 Bacteria 2489
63 Ga0415639_072995 3300038395 Bacteria 3768
64 Ga0466694_070037 3300042594 Bacteria 5075
65 Ga0466695_047016 3300042595 Bacteria 3012
66 Ga0466699_231483 3300042597 Bacteria 1695
67 IMNBL1DRAFT_c0000697 3300000062 Bacteria 26957
68 JGI24698J34947_10016363 3300002449 Bacteria 4025
69 JGI24695J34938_10002765 3300002450 Bacteria 12886
70 JGI24695J34938_10002914 3300002450 Bacteria 12428
71 JGI24695J34938_10003413 3300002450 Bacteria 11123
72 JGI24702J35022_10006107 3300002462 Bacteria 6992
73 Ga0104148_1085436 3300007226 Unclassified 1916
74 Ga0466732_391959 3300042656 Bacteria 1324
75 Ga0123356_10000626 3300010049 Bacteria 39002
76 Ga0123353_11213107 3300010167 Bacteria 989
77 Ga0466718_007069 3300042617 Bacteria 1047
78 Ga0466718_011452 3300042617 Bacteria 22863
79 Ga0466723_195871 3300042618 Bacteria 20538
80 Ga0466726_393740 3300042619 Bacteria 1380
81 Ga0466735_236145 3300042624 Bacteria 1448
82 Ga0466704_608546 3300042643 Bacteria 1713
83 Ga0466700_310786 3300042600 Bacteria 1476
84 Ga0466719_420593 3300042606 Bacteria 1687
85 Ga0160472_100022 3300012839 Bacteria 329165
86 Ga0466693_137411 3300042592 Bacteria 2461
87 Ga0466694_152628 3300042594 Bacteria 2439
88 JGI24695J34938_10000023 3300002450 Bacteria 110103
89 JGI24695J34938_10003904 3300002450 Bacteria 10083
90 JGI24695J34938_10012141 3300002450 Bacteria 4586
91 JGI24700J35501_10930911 3300002508 Bacteria 40904
92 Ga0063521_1000020 3300003973 Bacteria 138309
93 Ga0104148_1018516 3300007226 Unclassified 2019
94 Ga0105553_1001637 3300007767 Unclassified 3187
95 Ga0123353_10657526 3300010167 Bacteria 1482
96 Ga0466711_297715 3300042615 Bacteria 7484
97 Ga0466723_345586 3300042618 Bacteria 28546
98 Ga0466704_341128 3300042643 Bacteria 5855
99 Ga0466709_336219 3300042648 Bacteria 9389
100 Ga0466727_051312 3300042655 Bacteria 5273
101 Ga0466706_067257 3300042599 Bacteria 1586
102 Ga0466716_037911 3300042605 Bacteria 6025
103 Ga0316159_10002 3300030930 Bacteria 247683
104 Ga0415639_072178 3300038395 Bacteria 1784
105 Ga0466693_106800 3300042592 Bacteria 1069
106 Ga0466694_288433 3300042594 Bacteria 37936
107 Ga0466699_121434 3300042597 Bacteria 8802
108 JGI24695J34938_10012165 3300002450 Bacteria 4582
109 JGI24695J34938_10056608 3300002450 Unclassified 1689
110 JGI24702J35022_10001953 3300002462 Unclassified 12709
111 JGI24703J35330_11748866 3300002501 Bacteria 64618
112 Ga0104147_1003191 3300007224 Unclassified 2573
113 Ga0466705_380760 3300042612 Bacteria 5160
114 Ga0123356_10035686 3300010049 Bacteria 4644
115 Ga0466726_193270 3300042619 Bacteria 5508
116 Ga0466735_070253 3300042624 Bacteria 3831
117 Ga0466709_381462 3300042648 Bacteria 14014
118 Ga0466708_258264 3300042652 Bacteria 68689
119 Ga0466706_139159 3300042599 Bacteria 3092
120 Ga0466713_096260 3300042602 Bacteria 4749
121 Ga0466691_184999 3300042593 Bacteria 2427
122 JGI24698J34947_10023881 3300002449 Bacteria 3268
123 JGI24695J34938_10000140 3300002450 Bacteria 65738
124 JGI24695J34938_10003663 3300002450 Bacteria 10530
125 Ga0105008_1098799 3300007507 Unclassified 3791
126 Ga0466705_168798 3300042612 Bacteria 16173
127 Ga0562377_0016 3300056842 Bacteria 1202354
128 Ga0123356_10000688 3300010049 Bacteria 37446
129 Ga0123356_10020691 3300010049 Bacteria 6222
130 Ga0466712_028872 3300042614 Bacteria 1462
131 Ga0466712_142554 3300042614 Bacteria 1046
132 Ga0466712_274684 3300042614 Bacteria 1584
133 Ga0466711_322087 3300042615 Bacteria 11104
134 Ga0466715_060772 3300042616 Bacteria 11366
135 Ga0466723_116918 3300042618 Bacteria 5135
136 Ga0466735_184070 3300042624 Bacteria 1167
137 Ga0466706_115677 3300042599 Bacteria 48235
138 Ga0466706_127056 3300042599 Bacteria 3061
139 Ga0466706_212091 3300042599 Bacteria 5136
140 Ga0415639_044390 3300038395 Bacteria 2918
141 Ga0466696_265844 3300042596 Bacteria 7991
142 Ga0466699_317814 3300042597 Bacteria 1106
143 Ga0466699_349160 3300042597 Bacteria 3124
144 JGI24695J34938_10026168 3300002450 Bacteria 2776
145 Ga0074317_1119355 3300005320 Unclassified 2273
146 Ga0105006_1175260 3300007506 Unclassified 1144
147 Ga0105553_1083297 3300007767 Unclassified 2881
148 Ga0123357_10003299 3300009784 Bacteria 18425

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300007767 Ga0105553_1083297 Ga0105553_10832972 242
2 3300041968 Ga0456237_0016659 Ga0456237_0016659_114_860 248
3 3300007767 Ga0105553_1001637 Ga0105553_10016372 250
4 3300042601 Ga0466707_202459 Ga0466707_202459_109634_110455 255
5 3300042636 Ga0466703_071041 Ga0466703_071041_1961_2728 255
6 iso_pr_bacteria 2781125683 2781412062 255
7 3300042597 Ga0466699_156379 Ga0466699_156379_212_1045 256
8 3300042619 Ga0466726_393740 Ga0466726_393740_23_793 256
9 iso_pr_bacteria 2820309449 2820311808 256
10 3300002508 JGI24700J35501_10930911 JGI24700J35501_1093091116 257
11 3300007507 Ga0105008_1106204 Ga0105008_11062041 257
12 3300042597 Ga0466699_231483 Ga0466699_231483_342_1118 258
13 3300042594 Ga0466694_152628 Ga0466694_152628_513_1295 260
14 3300042648 Ga0466709_381462 Ga0466709_381462_9091_9873 260
15 3300002449 JGI24698J34947_10016363 JGI24698J34947_100163633 261
16 3300002449 JGI24698J34947_10036992 JGI24698J34947_100369923 261
17 3300042594 Ga0466694_070037 Ga0466694_070037_2669_3454 261
18 3300042617 Ga0466718_056323 Ga0466718_056323_2147_2932 261
19 3300002449 JGI24698J34947_10010590 JGI24698J34947_100105902 262
20 3300007507 Ga0105008_1097388 Ga0105008_10973883 262
21 3300042594 Ga0466694_288433 Ga0466694_288433_2190_2978 262
22 3300042614 Ga0466712_128693 Ga0466712_128693_1144_1986 262
23 3300042596 Ga0466696_465846 Ga0466696_465846_1239_2030 263
24 3300042597 Ga0466699_249699 Ga0466699_249699_108_899 263
25 3300042617 Ga0466718_011452 Ga0466718_011452_4871_5662 263
26 3300038395 Ga0415639_072995 Ga0415639_072995_887_1699 264
27 3300042597 Ga0466699_121434 Ga0466699_121434_6929_7723 264
28 3300005320 Ga0074317_1119355 Ga0074317_11193551 265
29 3300010167 Ga0123353_10040180 Ga0123353_100401807 265
30 3300042597 Ga0466699_317814 Ga0466699_317814_212_1039 265
31 3300042599 Ga0466706_039361 Ga0466706_039361_7796_8593 265
32 3300042599 Ga0466706_043928 Ga0466706_043928_8220_9017 265
33 3300042599 Ga0466706_115677 Ga0466706_115677_31913_32710 265
34 3300042599 Ga0466706_279036 Ga0466706_279036_687_1484 265
35 3300042618 Ga0466723_195871 Ga0466723_195871_13320_14147 265
36 3300042636 Ga0466703_327607 Ga0466703_327607_15392_16189 265
37 iso_pr_bacteria 2940264388 2940264556 265
38 iso_pr_bacteria 2940267548 2940267667 265
39 iso_pr_bacteria 2940270707 2940270826 265
40 iso_pr_bacteria 2940273867 2940274035 265
41 3300042597 Ga0466699_349160 Ga0466699_349160_1739_2539 266
42 3300042614 Ga0466712_268511 Ga0466712_268511_386_1201 266
43 3300042617 Ga0466718_032487 Ga0466718_032487_949_1764 266
44 iso_pr_bacteria 2781125647 2781302402 266
45 3300002449 JGI24698J34947_10026609 JGI24698J34947_100266092 267
46 3300002450 JGI24695J34938_10000023 JGI24695J34938_1000002324 267
47 3300007506 Ga0105006_1175260 Ga0105006_11752601 267
48 3300007507 Ga0105008_1098799 Ga0105008_10987991 267
49 3300042599 Ga0466706_139159 Ga0466706_139159_1745_2548 267
50 3300042600 Ga0466700_310786 Ga0466700_310786_58_861 267
51 3300042606 Ga0466719_046990 Ga0466719_046990_1467_2315 267
52 3300042619 Ga0466726_469675 Ga0466726_469675_1245_2048 267
53 iso_pr_bacteria 2590828839 2593250706 267
54 iso_pr_bacteria 2593339125 2595065768 267
55 iso_pr_bacteria 2781125642 2781292172 267
56 iso_pr_bacteria 2781125643 2781294223 267
57 iso_pr_bacteria 2781125643 2781294637 267
58 3300002450 JGI24695J34938_10000742 JGI24695J34938_100007421 268
59 3300002450 JGI24695J34938_10002765 JGI24695J34938_100027657 268
60 3300002450 JGI24695J34938_10003413 JGI24695J34938_1000341310 268
61 3300002450 JGI24695J34938_10013114 JGI24695J34938_100131146 268
62 3300002450 JGI24695J34938_10024106 JGI24695J34938_100241061 268
63 3300005322 Ga0074314_1146080 Ga0074314_11460801 268
64 3300007507 Ga0105008_1103156 Ga0105008_11031562 268
65 3300042648 Ga0466709_204823 Ga0466709_204823_135406_136212 268
66 iso_pr_bacteria 2820347164 2820347690 268
67 iso_pr_bacteria 2898975184 2898977623 268
68 iso_pr_bacteria 2901296437 2901299259 268
69 3300000062 IMNBL1DRAFT_c0000697 IMNBL1DRAFT_00006978 269
70 3300030930 Ga0316159_10002 Ga0316159_10002124 269
71 3300042606 Ga0466719_420593 Ga0466719_420593_315_1124 269
72 3300042618 Ga0466723_182672 Ga0466723_182672_1201_2010 269
73 iso_pr_bacteria 2505679062 2505924767 269
74 iso_pr_bacteria 2585427711 2586306578 269
75 iso_pr_bacteria 2651870110 2653795929 269
76 iso_pr_bacteria 2781125685 2781417718 269
77 iso_pr_bacteria 2898991528 2898994912 269
78 iso_pr_bacteria 2940241992 2940244124 269
79 iso_pr_bacteria 2940349480 2940351618 269
80 iso_pr_bacteria 8099192374 8099195884 269
81 iso_pr_bacteria 8103008710 8103013092 269
82 3300000062 IMNBL1DRAFT_c0000372 IMNBL1DRAFT_00003724 270
83 3300003973 Ga0063521_1000020 Ga0063521_100002061 270
84 3300003973 Ga0063521_1000166 Ga0063521_100016637 270
85 3300009457 Ga0127657_185103 Ga0127657_1851032 270
86 3300009826 Ga0123355_10455546 Ga0123355_104555462 270
87 3300030930 Ga0316159_11863 Ga0316159_118632 270
88 3300038395 Ga0415639_072178 Ga0415639_072178_891_1703 270
89 3300038395 Ga0415639_084401 Ga0415639_084401_712_1524 270
90 3300042612 Ga0466705_368221 Ga0466705_368221_179_991 270
91 3300056842 Ga0562377_0016 Ga0562377_0016_1164016_1164828 270
92 iso_pr_bacteria 2619619082 2620612585 270
93 iso_pr_bacteria 2820227065 2820227240 270
94 iso_pr_bacteria 2871760914 2871763334 270
95 iso_pr_bacteria 2871771314 2871772860 270
96 iso_pr_bacteria 648276708 648767460 270
97 iso_pr_bacteria 651324086 651695998 270
98 iso_pr_bacteria 8102982778 8102987346 270
99 iso_pr_bacteria 8103002986 8103007829 270
100 3300002450 JGI24695J34938_10012165 JGI24695J34938_100121654 271
101 3300002462 JGI24702J35022_10001953 JGI24702J35022_100019534 271
102 3300012839 Ga0160472_100022 Ga0160472_10002288 271
103 iso_pr_bacteria 2645727860 2647288283 271
104 iso_pr_bacteria 2648501209 2648984376 271
105 iso_pr_bacteria 2820371985 2820373808 271
106 3300010167 Ga0123353_10657526 Ga0123353_106575262 272
107 3300042606 Ga0466719_102351 Ga0466719_102351_7473_8291 272
108 3300042612 Ga0466705_380760 Ga0466705_380760_2316_3134 272
109 3300042614 Ga0466712_274684 Ga0466712_274684_80_898 272
110 3300042617 Ga0466718_007069 Ga0466718_007069_127_945 272
111 3300042648 Ga0466709_336219 Ga0466709_336219_4522_5340 272
112 iso_pr_bacteria 2820647881 2820650205 272
113 3300005201 Ga0072941_1028944 Ga0072941_10289448 273
114 3300042599 Ga0466706_180766 Ga0466706_180766_29280_30101 273
115 iso_pr_bacteria 2781125635 2781276681 273
116 iso_pr_bacteria 2781125645 2781298260 273
117 iso_pr_bacteria 2781125657 2781323671 273
118 iso_pr_bacteria 2781125665 2781342091 273
119 iso_pr_bacteria 2781125697 2781442824 273
120 3300002450 JGI24695J34938_10000140 JGI24695J34938_100001403 274
121 3300002450 JGI24695J34938_10030010 JGI24695J34938_100300102 274
122 3300002462 JGI24702J35022_10006107 JGI24702J35022_100061079 274
123 3300010049 Ga0123356_10000626 Ga0123356_1000062622 274
124 3300010049 Ga0123356_10000688 Ga0123356_1000068814 274
125 3300010049 Ga0123356_10020691 Ga0123356_100206916 274
126 3300038395 Ga0415639_044390 Ga0415639_044390_736_1560 274
127 3300042596 Ga0466696_265844 Ga0466696_265844_376_1200 274
128 3300042615 Ga0466711_322087 Ga0466711_322087_150_1010 274
129 3300042624 Ga0466735_137926 Ga0466735_137926_29_853 274
130 3300042624 Ga0466735_184070 Ga0466735_184070_278_1102 274
131 3300002450 JGI24695J34938_10056608 JGI24695J34938_100566082 275
132 3300010167 Ga0123353_10503474 Ga0123353_105034741 275
133 3300042592 Ga0466693_106800 Ga0466693_106800_114_941 275
134 3300042599 Ga0466706_212091 Ga0466706_212091_584_1411 275
135 3300042619 Ga0466726_193270 Ga0466726_193270_633_1460 275
136 3300042622 Ga0466731_303959 Ga0466731_303959_156_983 275
137 iso_pr_bacteria 2781125688 2781423421 275
138 iso_pr_bacteria 2820831444 2820832371 275
139 3300010882 Ga0123354_10063095 Ga0123354_100630953 276
140 3300042599 Ga0466706_127056 Ga0466706_127056_951_1781 276
141 iso_pr_bacteria 2781125633 2781272934 276
142 3300002450 JGI24695J34938_10002914 JGI24695J34938_100029146 277
143 3300002450 JGI24695J34938_10003663 JGI24695J34938_1000366310 277
144 3300010049 Ga0123356_10035686 Ga0123356_100356864 277
145 3300010167 Ga0123353_11213107 Ga0123353_112131071 277
146 3300042602 Ga0466713_096260 Ga0466713_096260_1914_2807 277
147 3300042614 Ga0466712_028872 Ga0466712_028872_332_1165 277
148 3300042614 Ga0466712_142554 Ga0466712_142554_192_1025 277
149 3300042615 Ga0466711_297715 Ga0466711_297715_2902_3765 277
150 3300042636 Ga0466703_130543 Ga0466703_130543_465_1340 277
151 iso_pr_bacteria 2513237114 2513781191 277
152 iso_pr_bacteria 2781125634 2781275720 277
153 iso_pr_bacteria 2831380896 2831381205 277
154 iso_pr_bacteria 8065340634 8065340941 277
155 3300002450 JGI24695J34938_10026168 JGI24695J34938_100261682 278
156 3300042599 Ga0466706_067257 Ga0466706_067257_593_1429 278
157 3300042616 Ga0466715_132867 Ga0466715_132867_2984_3820 278
158 2225789004 2227253017 2227696737 279
159 3300002450 JGI24695J34938_10003904 JGI24695J34938_100039042 279
160 3300042593 Ga0466691_184999 Ga0466691_184999_1445_2284 279
161 3300042619 Ga0466726_437260 Ga0466726_437260_3627_4466 279
162 3300042643 Ga0466704_341128 Ga0466704_341128_2170_3009 279
163 3300042643 Ga0466704_608546 Ga0466704_608546_66_905 279
164 3300042656 Ga0466732_039367 Ga0466732_039367_12195_13034 279
165 3300042656 Ga0466732_391959 Ga0466732_391959_472_1311 279
166 3300002450 JGI24695J34938_10010628 JGI24695J34938_100106285 280
167 3300002450 JGI24695J34938_10018892 JGI24695J34938_100188923 280
168 3300042592 Ga0466693_137411 Ga0466693_137411_537_1379 280
169 3300042616 Ga0466715_578803 Ga0466715_578803_2696_3538 280
170 3300042612 Ga0466705_322993 Ga0466705_322993_3129_3974 281
171 iso_pr_bacteria 2772190978 2773730002 281
172 3300002449 JGI24698J34947_10004110 JGI24698J34947_100041105 282
173 3300002449 JGI24698J34947_10023881 JGI24698J34947_100238813 282
174 iso_pr_bacteria 2781125666 2781345365 282
175 3300009784 Ga0123357_10003299 Ga0123357_1000329911 283
176 3300042655 Ga0466727_051312 Ga0466727_051312_494_1345 283
177 3300056814 Ga0562378_0469 Ga0562378_0469_54511_55362 283
178 iso_pr_bacteria 2820507989 2820510220 283
179 3300002450 JGI24695J34938_10012141 JGI24695J34938_100121415 284
180 3300038395 Ga0415639_044392 Ga0415639_044392_774_1628 284
181 3300042605 Ga0466716_037911 Ga0466716_037911_1213_2067 284
182 3300042606 Ga0466719_207405 Ga0466719_207405_2935_3789 284
183 3300042607 Ga0466720_179107 Ga0466720_179107_243_1097 284
184 3300042648 Ga0466709_370938 Ga0466709_370938_668_1522 284
185 3300042652 Ga0466708_258264 Ga0466708_258264_19256_20110 284
186 3300042655 Ga0466727_019591 Ga0466727_019591_579_1433 284
187 iso_pr_bacteria 2820277137 2820278563 284
188 3300002501 JGI24703J35330_11748866 JGI24703J35330_1174886628 286
189 3300042656 Ga0466732_193136 Ga0466732_193136_2345_3205 286
190 3300042595 Ga0466695_047016 Ga0466695_047016_1498_2367 289
191 3300042612 Ga0466705_168798 Ga0466705_168798_13486_14355 289
192 iso_pr_bacteria 2781125640 2781287257 289
193 3300042618 Ga0466723_345586 Ga0466723_345586_20191_21066 291
194 3300042620 Ga0466728_341464 Ga0466728_341464_188_1063 291
195 3300042624 Ga0466735_070253 Ga0466735_070253_2891_3766 291
196 3300042624 Ga0466735_236145 Ga0466735_236145_104_979 291
197 iso_pr_bacteria 650716102 650880858 291
198 3300042616 Ga0466715_060772 Ga0466715_060772_2672_3559 295
199 3300007224 Ga0104147_1003191 Ga0104147_10031912 296
200 3300007226 Ga0104148_1018516 Ga0104148_10185161 296
201 3300007226 Ga0104148_1085436 Ga0104148_10854361 296
202 3300042618 Ga0466723_116918 Ga0466723_116918_114_1070 318

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF14748 P5CR_dimer Pyrroline-5-carboxylate reductase dimerisation 210 313 0.98
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 47 146 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.