Protein Family IF08052
Metagenome
Isolate
124
Members
47
Samples
122
Scaffolds
261.08
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_098234|Ga0466723_098234_1816_2697
- Length
- 293 aa
- Sequence
- MIYLKTDEEIALMREANQLVGKTLGELAKHIRPGVTTLQLDQIADAFIRDHGAVPAFLGYQGFPKSLCTSVNEQVVHGIPSAQTVLKDGDIISIDCGTVLNGFVGDSAYTFCVGEVSEEIKRLLRTTKEALYEGIRQATVGHRTGDISNAVQSYCETRGYSVVRELSGHGCGRKMHEDPAVPNYGRCGCGPLLRSGMCICIEPMINLGSKNVTIEKDGWTVRTKDRKYSAHFEHCIALRPEGPMILSSFDYVEKTTGKEIMNIYGETGCNRTGWSDSGCTVQCDVSCRVGKRT
Sample Types
Isolate
1.6%
Metagenome
98.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.0%
Kalotermitidae
30.4%
Termopsidae
8.7%
Unclassified
6.5%
Passalidae
6.5%
Rhinotermitidae
4.3%
Blattidae
4.3%
Drosophilidae
2.2%
Taxonomy
Archaea
0
Bacteria
121
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 6 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 7 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 10 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 11 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 12 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 13 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 14 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300005309 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut | Metagenome | Drosophilidae |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 21 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 26 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 27 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 28 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 29 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 30 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 31 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 32 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 33 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 35 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 36 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 37 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 38 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 39 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 40 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 41 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 42 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 43 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 46 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 47 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | IMNBL1DRAFT_c0001005 | 3300000062 | Bacteria | 21736 |
| 2 | Ga0068305_10005585 | 3300005083 | Bacteria | 21211 |
| 3 | Ga0068305_10026156 | 3300005083 | Bacteria | 20761 |
| 4 | Ga0068305_10210472 | 3300005083 | Bacteria | 6530 |
| 5 | Ga0072941_1290283 | 3300005201 | Bacteria | 3435 |
| 6 | Ga0123356_10056470 | 3300010049 | Bacteria | 3658 |
| 7 | Ga0466715_045203 | 3300042616 | Bacteria | 21834 |
| 8 | Ga0466715_177954 | 3300042616 | Bacteria | 14578 |
| 9 | Ga0466728_018673 | 3300042620 | Bacteria | 22808 |
| 10 | Ga0466656_114744 | 3300042550 | Bacteria | 1174 |
| 11 | Ga0466703_381553 | 3300042636 | Bacteria | 3912 |
| 12 | Ga0466704_300588 | 3300042643 | Bacteria | 28806 |
| 13 | Ga0466705_019476 | 3300042612 | Bacteria | 24974 |
| 14 | Ga0466727_352642 | 3300042655 | Bacteria | 45291 |
| 15 | Ga0466732_295393 | 3300042656 | Bacteria | 3668 |
| 16 | 2227310796 | 2225789004 | Bacteria | 1205 |
| 17 | JGI24702J35022_10005168 | 3300002462 | Bacteria | 7657 |
| 18 | Ga0068305_10061301 | 3300005083 | Bacteria | 11640 |
| 19 | Ga0123356_10013446 | 3300010049 | Bacteria | 7898 |
| 20 | Ga0466656_127609 | 3300042550 | Bacteria | 23908 |
| 21 | Ga0466690_133803 | 3300042590 | Bacteria | 6992 |
| 22 | Ga0466690_383037 | 3300042590 | Bacteria | 7258 |
| 23 | Ga0466707_152952 | 3300042601 | Bacteria | 15357 |
| 24 | Ga0466713_022772 | 3300042602 | Bacteria | 15388 |
| 25 | Ga0466713_049915 | 3300042602 | Bacteria | 7827 |
| 26 | Ga0466717_022654 | 3300042604 | Bacteria | 2936 |
| 27 | Ga0466716_386731 | 3300042605 | Bacteria | 3206 |
| 28 | Ga0466719_246678 | 3300042606 | Bacteria | 8577 |
| 29 | Ga0466722_161726 | 3300042609 | Bacteria | 14778 |
| 30 | Ga0466703_019525 | 3300042636 | Bacteria | 29012 |
| 31 | Ga0466704_472759 | 3300042643 | Bacteria | 20123 |
| 32 | Ga0466704_552057 | 3300042643 | Bacteria | 6449 |
| 33 | Ga0466697_112124 | 3300042611 | Bacteria | 1453 |
| 34 | Ga0068305_10015112 | 3300005083 | Bacteria | 28238 |
| 35 | Ga0072940_1230882 | 3300005200 | Bacteria | 1207 |
| 36 | Ga0466715_434053 | 3300042616 | Bacteria | 17606 |
| 37 | Ga0466723_373256 | 3300042618 | Bacteria | 33738 |
| 38 | Ga0466728_105299 | 3300042620 | Bacteria | 55474 |
| 39 | Ga0466693_443344 | 3300042592 | Bacteria | 1086 |
| 40 | Ga0466707_398960 | 3300042601 | Bacteria | 15809 |
| 41 | Ga0466713_137499 | 3300042602 | Bacteria | 46639 |
| 42 | Ga0466719_287899 | 3300042606 | Bacteria | 12579 |
| 43 | Ga0466735_086882 | 3300042624 | Bacteria | 60782 |
| 44 | Ga0466703_249699 | 3300042636 | Bacteria | 47455 |
| 45 | Ga0466704_533188 | 3300042643 | Bacteria | 20326 |
| 46 | Ga0466727_290408 | 3300042655 | Bacteria | 5174 |
| 47 | Ga0466705_023652 | 3300042612 | Bacteria | 16774 |
| 48 | IMNBGM34_c000179 | 3300000036 | Bacteria | 18779 |
| 49 | JGI24698J34947_10036615 | 3300002449 | Bacteria | 2554 |
| 50 | JGI24702J35022_10177706 | 3300002462 | Unclassified | 1207 |
| 51 | Ga0068302_10052331 | 3300005071 | Bacteria | 1509 |
| 52 | Ga0466723_093881 | 3300042618 | Bacteria | 35007 |
| 53 | Ga0466723_098234 | 3300042618 | Bacteria | 5578 |
| 54 | Ga0466726_158392 | 3300042619 | Bacteria | 6926 |
| 55 | Ga0466728_046729 | 3300042620 | Bacteria | 48709 |
| 56 | Ga0466713_014085 | 3300042602 | Bacteria | 3545 |
| 57 | Ga0466713_066319 | 3300042602 | Bacteria | 5387 |
| 58 | Ga0466713_072740 | 3300042602 | Bacteria | 29878 |
| 59 | Ga0466709_223255 | 3300042648 | Bacteria | 9867 |
| 60 | Ga0466708_169565 | 3300042652 | Bacteria | 34312 |
| 61 | 2227129983 | 2225789004 | Bacteria | 1665 |
| 62 | JGI24702J35022_10000840 | 3300002462 | Bacteria | 18966 |
| 63 | JGI24705J35276_12238337 | 3300002504 | Bacteria | 19543 |
| 64 | Ga0123353_10140364 | 3300010167 | Bacteria | 3871 |
| 65 | Ga0466711_136776 | 3300042615 | Bacteria | 4604 |
| 66 | Ga0466715_400061 | 3300042616 | Bacteria | 8569 |
| 67 | Ga0466715_586714 | 3300042616 | Bacteria | 57830 |
| 68 | Ga0466718_082872 | 3300042617 | Bacteria | 2936 |
| 69 | Ga0466728_069680 | 3300042620 | Bacteria | 49538 |
| 70 | Ga0466728_401287 | 3300042620 | Unclassified | 1064 |
| 71 | Ga0466690_032772 | 3300042590 | Bacteria | 29534 |
| 72 | Ga0466690_121023 | 3300042590 | Bacteria | 1387 |
| 73 | Ga0466691_039529 | 3300042593 | Bacteria | 29822 |
| 74 | Ga0466699_066134 | 3300042597 | Bacteria | 8219 |
| 75 | Ga0466707_374739 | 3300042601 | Bacteria | 28797 |
| 76 | Ga0466713_105089 | 3300042602 | Bacteria | 7697 |
| 77 | Ga0466716_014479 | 3300042605 | Bacteria | 30537 |
| 78 | Ga0466719_204065 | 3300042606 | Bacteria | 20051 |
| 79 | Ga0466704_477103 | 3300042643 | Bacteria | 9640 |
| 80 | Ga0466727_040337 | 3300042655 | Bacteria | 31698 |
| 81 | Ga0466727_050462 | 3300042655 | Bacteria | 20965 |
| 82 | Ga0466732_343159 | 3300042656 | Bacteria | 2046 |
| 83 | Ga0466733_028819 | 3300042659 | Bacteria | 27870 |
| 84 | 2227414124 | 2225789004 | Unclassified | 26599 |
| 85 | JGI24702J35022_10036958 | 3300002462 | Bacteria | 2609 |
| 86 | Ga0068305_10010112 | 3300005083 | Bacteria | 17726 |
| 87 | Ga0123353_10423614 | 3300010167 | Bacteria | 1971 |
| 88 | Ga0466715_044375 | 3300042616 | Bacteria | 14700 |
| 89 | Ga0466692_142563 | 3300042591 | Bacteria | 9391 |
| 90 | Ga0466707_043333 | 3300042601 | Bacteria | 3390 |
| 91 | Ga0466713_026562 | 3300042602 | Bacteria | 15627 |
| 92 | Ga0466713_051236 | 3300042602 | Bacteria | 4898 |
| 93 | Ga0466713_056121 | 3300042602 | Bacteria | 24333 |
| 94 | Ga0466716_069138 | 3300042605 | Bacteria | 3883 |
| 95 | Ga0466719_292822 | 3300042606 | Bacteria | 42754 |
| 96 | Ga0466722_088834 | 3300042609 | Bacteria | 20099 |
| 97 | Ga0466703_259701 | 3300042636 | Bacteria | 11196 |
| 98 | Ga0466727_289772 | 3300042655 | Bacteria | 14123 |
| 99 | Ga0466705_111418 | 3300042612 | Bacteria | 19183 |
| 100 | Ga0466727_349423 | 3300042655 | Bacteria | 30219 |
| 101 | 2227339122 | 2225789004 | Bacteria | 6266 |
| 102 | JGI24702J35022_10003569 | 3300002462 | Bacteria | 9369 |
| 103 | Ga0068302_10144091 | 3300005071 | Bacteria | 1953 |
| 104 | Ga0466711_120016 | 3300042615 | Bacteria | 45710 |
| 105 | Ga0466726_242160 | 3300042619 | Bacteria | 13880 |
| 106 | Ga0466696_251297 | 3300042596 | Bacteria | 5849 |
| 107 | Ga0466713_027800 | 3300042602 | Bacteria | 40167 |
| 108 | Ga0466722_073972 | 3300042609 | Bacteria | 128406 |
| 109 | Ga0466722_092513 | 3300042609 | Bacteria | 5363 |
| 110 | Ga0466722_114311 | 3300042609 | Bacteria | 8028 |
| 111 | Ga0466708_254314 | 3300042652 | Bacteria | 24323 |
| 112 | Ga0466725_037990 | 3300042654 | Bacteria | 18222 |
| 113 | JGI24702J35022_10004210 | 3300002462 | Bacteria | 8590 |
| 114 | Ga0074306_1119219 | 3300005309 | Bacteria | 1455 |
| 115 | Ga0466693_119883 | 3300042592 | Bacteria | 2828 |
| 116 | Ga0466696_467126 | 3300042596 | Bacteria | 3977 |
| 117 | Ga0466701_001061 | 3300042598 | Bacteria | 1540 |
| 118 | Ga0466713_079678 | 3300042602 | Bacteria | 62372 |
| 119 | Ga0466716_075598 | 3300042605 | Bacteria | 6015 |
| 120 | Ga0466731_198267 | 3300042622 | Bacteria | 2052 |
| 121 | Ga0466704_515225 | 3300042643 | Bacteria | 1558 |
| 122 | Ga0466709_400546 | 3300042648 | Bacteria | 20980 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042622 | Ga0466731_198267 | Ga0466731_198267_15_764 | 249 |
| 2 | 3300042602 | Ga0466713_051236 | Ga0466713_051236_2455_3216 | 253 |
| 3 | 3300042602 | Ga0466713_066319 | Ga0466713_066319_3298_4059 | 253 |
| 4 | 3300042616 | Ga0466715_044375 | Ga0466715_044375_9366_10127 | 253 |
| 5 | 3300042590 | Ga0466690_383037 | Ga0466690_383037_1913_2677 | 254 |
| 6 | 3300042606 | Ga0466719_246678 | Ga0466719_246678_3409_4173 | 254 |
| 7 | 3300042591 | Ga0466692_142563 | Ga0466692_142563_4394_5170 | 258 |
| 8 | 3300042609 | Ga0466722_073972 | Ga0466722_073972_16949_17725 | 258 |
| 9 | 3300042624 | Ga0466735_086882 | Ga0466735_086882_20074_20850 | 258 |
| 10 | 2225789004 | 2227129983 | 2227526608 | 260 |
| 11 | 2225789004 | 2227310796 | 2227760332 | 260 |
| 12 | 2225789004 | 2227339122 | 2227786159 | 260 |
| 13 | 2225789004 | 2227414124 | 2227855794 | 260 |
| 14 | 3300042550 | Ga0466656_114744 | Ga0466656_114744_288_1070 | 260 |
| 15 | 3300042550 | Ga0466656_127609 | Ga0466656_127609_11097_11879 | 260 |
| 16 | 3300042590 | Ga0466690_032772 | Ga0466690_032772_28252_29034 | 260 |
| 17 | 3300042590 | Ga0466690_121023 | Ga0466690_121023_284_1066 | 260 |
| 18 | 3300042590 | Ga0466690_133803 | Ga0466690_133803_4163_4945 | 260 |
| 19 | 3300042593 | Ga0466691_039529 | Ga0466691_039529_14599_15381 | 260 |
| 20 | 3300042596 | Ga0466696_251297 | Ga0466696_251297_3770_4552 | 260 |
| 21 | 3300042596 | Ga0466696_467126 | Ga0466696_467126_1957_2739 | 260 |
| 22 | 3300042597 | Ga0466699_066134 | Ga0466699_066134_4263_5045 | 260 |
| 23 | 3300042601 | Ga0466707_043333 | Ga0466707_043333_178_960 | 260 |
| 24 | 3300042601 | Ga0466707_152952 | Ga0466707_152952_2157_2939 | 260 |
| 25 | 3300042601 | Ga0466707_398960 | Ga0466707_398960_8961_9743 | 260 |
| 26 | 3300042602 | Ga0466713_026562 | Ga0466713_026562_6160_6942 | 260 |
| 27 | 3300042602 | Ga0466713_027800 | Ga0466713_027800_7604_8386 | 260 |
| 28 | 3300042602 | Ga0466713_072740 | Ga0466713_072740_12250_13032 | 260 |
| 29 | 3300042602 | Ga0466713_079678 | Ga0466713_079678_48235_49017 | 260 |
| 30 | 3300042602 | Ga0466713_137499 | Ga0466713_137499_21753_22535 | 260 |
| 31 | 3300042604 | Ga0466717_022654 | Ga0466717_022654_1045_1827 | 260 |
| 32 | 3300042605 | Ga0466716_014479 | Ga0466716_014479_4319_5101 | 260 |
| 33 | 3300042605 | Ga0466716_069138 | Ga0466716_069138_2346_3128 | 260 |
| 34 | 3300042605 | Ga0466716_386731 | Ga0466716_386731_1655_2437 | 260 |
| 35 | 3300042606 | Ga0466719_204065 | Ga0466719_204065_4817_5599 | 260 |
| 36 | 3300042606 | Ga0466719_287899 | Ga0466719_287899_3564_4346 | 260 |
| 37 | 3300042606 | Ga0466719_292822 | Ga0466719_292822_18945_19727 | 260 |
| 38 | 3300042609 | Ga0466722_088834 | Ga0466722_088834_4072_4854 | 260 |
| 39 | 3300042611 | Ga0466697_112124 | Ga0466697_112124_619_1401 | 260 |
| 40 | 3300042612 | Ga0466705_019476 | Ga0466705_019476_10313_11095 | 260 |
| 41 | 3300042612 | Ga0466705_023652 | Ga0466705_023652_10328_11110 | 260 |
| 42 | 3300042612 | Ga0466705_111418 | Ga0466705_111418_3330_4112 | 260 |
| 43 | 3300042615 | Ga0466711_120016 | Ga0466711_120016_17918_18700 | 260 |
| 44 | 3300042616 | Ga0466715_400061 | Ga0466715_400061_3362_4144 | 260 |
| 45 | 3300042616 | Ga0466715_434053 | Ga0466715_434053_14001_14783 | 260 |
| 46 | 3300042616 | Ga0466715_586714 | Ga0466715_586714_36684_37466 | 260 |
| 47 | 3300042617 | Ga0466718_082872 | Ga0466718_082872_637_1419 | 260 |
| 48 | 3300042618 | Ga0466723_093881 | Ga0466723_093881_15170_15952 | 260 |
| 49 | 3300042618 | Ga0466723_373256 | Ga0466723_373256_4007_4789 | 260 |
| 50 | 3300042619 | Ga0466726_158392 | Ga0466726_158392_648_1430 | 260 |
| 51 | 3300042619 | Ga0466726_242160 | Ga0466726_242160_9942_10724 | 260 |
| 52 | 3300042620 | Ga0466728_018673 | Ga0466728_018673_15439_16221 | 260 |
| 53 | 3300042620 | Ga0466728_401287 | Ga0466728_401287_43_825 | 260 |
| 54 | 3300042636 | Ga0466703_019525 | Ga0466703_019525_17729_18511 | 260 |
| 55 | 3300042636 | Ga0466703_249699 | Ga0466703_249699_41326_42108 | 260 |
| 56 | 3300042636 | Ga0466703_259701 | Ga0466703_259701_5385_6167 | 260 |
| 57 | 3300042643 | Ga0466704_300588 | Ga0466704_300588_3549_4331 | 260 |
| 58 | 3300042643 | Ga0466704_472759 | Ga0466704_472759_13281_14063 | 260 |
| 59 | 3300042643 | Ga0466704_477103 | Ga0466704_477103_573_1355 | 260 |
| 60 | 3300042643 | Ga0466704_533188 | Ga0466704_533188_5160_5942 | 260 |
| 61 | 3300042643 | Ga0466704_552057 | Ga0466704_552057_507_1289 | 260 |
| 62 | 3300042648 | Ga0466709_223255 | Ga0466709_223255_3868_4650 | 260 |
| 63 | 3300042648 | Ga0466709_400546 | Ga0466709_400546_8609_9391 | 260 |
| 64 | 3300042652 | Ga0466708_169565 | Ga0466708_169565_28507_29289 | 260 |
| 65 | 3300042652 | Ga0466708_254314 | Ga0466708_254314_16472_17254 | 260 |
| 66 | 3300042655 | Ga0466727_040337 | Ga0466727_040337_12625_13407 | 260 |
| 67 | 3300042655 | Ga0466727_050462 | Ga0466727_050462_4093_4875 | 260 |
| 68 | 3300042655 | Ga0466727_289772 | Ga0466727_289772_9899_10681 | 260 |
| 69 | 3300042655 | Ga0466727_290408 | Ga0466727_290408_1963_2745 | 260 |
| 70 | 3300042655 | Ga0466727_349423 | Ga0466727_349423_3649_4431 | 260 |
| 71 | 3300042655 | Ga0466727_352642 | Ga0466727_352642_22548_23330 | 260 |
| 72 | 3300042659 | Ga0466733_028819 | Ga0466733_028819_12964_13746 | 260 |
| 73 | 3300000062 | IMNBL1DRAFT_c0001005 | IMNBL1DRAFT_00010055 | 261 |
| 74 | 3300002449 | JGI24698J34947_10036615 | JGI24698J34947_100366154 | 261 |
| 75 | 3300002462 | JGI24702J35022_10000840 | JGI24702J35022_1000084024 | 261 |
| 76 | 3300002462 | JGI24702J35022_10003569 | JGI24702J35022_1000356912 | 261 |
| 77 | 3300002462 | JGI24702J35022_10004210 | JGI24702J35022_100042108 | 261 |
| 78 | 3300002462 | JGI24702J35022_10005168 | JGI24702J35022_100051689 | 261 |
| 79 | 3300002462 | JGI24702J35022_10036958 | JGI24702J35022_100369581 | 261 |
| 80 | 3300002462 | JGI24702J35022_10177706 | JGI24702J35022_101777062 | 261 |
| 81 | 3300002504 | JGI24705J35276_12238337 | JGI24705J35276_1223833718 | 261 |
| 82 | 3300005071 | Ga0068302_10052331 | Ga0068302_100523312 | 261 |
| 83 | 3300005071 | Ga0068302_10144091 | Ga0068302_101440912 | 261 |
| 84 | 3300005083 | Ga0068305_10005585 | Ga0068305_1000558525 | 261 |
| 85 | 3300005083 | Ga0068305_10010112 | Ga0068305_1001011228 | 261 |
| 86 | 3300005083 | Ga0068305_10015112 | Ga0068305_1001511211 | 261 |
| 87 | 3300005083 | Ga0068305_10026156 | Ga0068305_1002615626 | 261 |
| 88 | 3300005083 | Ga0068305_10210472 | Ga0068305_102104727 | 261 |
| 89 | 3300005201 | Ga0072941_1290283 | Ga0072941_12902835 | 261 |
| 90 | 3300010049 | Ga0123356_10013446 | Ga0123356_100134464 | 261 |
| 91 | 3300010049 | Ga0123356_10056470 | Ga0123356_100564704 | 261 |
| 92 | 3300010167 | Ga0123353_10423614 | Ga0123353_104236142 | 261 |
| 93 | 3300042592 | Ga0466693_119883 | Ga0466693_119883_738_1523 | 261 |
| 94 | 3300042602 | Ga0466713_014085 | Ga0466713_014085_2095_2880 | 261 |
| 95 | 3300042605 | Ga0466716_075598 | Ga0466716_075598_3079_3864 | 261 |
| 96 | 3300042609 | Ga0466722_161726 | Ga0466722_161726_1854_2639 | 261 |
| 97 | 3300042616 | Ga0466715_177954 | Ga0466715_177954_6540_7325 | 261 |
| 98 | 3300042620 | Ga0466728_046729 | Ga0466728_046729_35528_36313 | 261 |
| 99 | 3300042620 | Ga0466728_069680 | Ga0466728_069680_35895_36680 | 261 |
| 100 | 3300042620 | Ga0466728_105299 | Ga0466728_105299_41474_42259 | 261 |
| 101 | 3300042656 | Ga0466732_295393 | Ga0466732_295393_2083_2868 | 261 |
| 102 | 3300005083 | Ga0068305_10061301 | Ga0068305_1006130121 | 262 |
| 103 | 3300005200 | Ga0072940_1230882 | Ga0072940_12308821 | 262 |
| 104 | 3300010167 | Ga0123353_10140364 | Ga0123353_101403646 | 262 |
| 105 | 3300042616 | Ga0466715_045203 | Ga0466715_045203_4268_5056 | 262 |
| 106 | 3300042609 | Ga0466722_114311 | Ga0466722_114311_2249_3040 | 263 |
| 107 | 3300042601 | Ga0466707_374739 | Ga0466707_374739_8966_9760 | 264 |
| 108 | 3300042602 | Ga0466713_056121 | Ga0466713_056121_938_1732 | 264 |
| 109 | 3300042615 | Ga0466711_136776 | Ga0466711_136776_3006_3800 | 264 |
| 110 | 3300042636 | Ga0466703_381553 | Ga0466703_381553_1792_2586 | 264 |
| 111 | 3300000036 | IMNBGM34_c000179 | IMNBGM34_00017912 | 265 |
| 112 | 3300042598 | Ga0466701_001061 | Ga0466701_001061_328_1125 | 265 |
| 113 | 3300042609 | Ga0466722_092513 | Ga0466722_092513_1128_1925 | 265 |
| 114 | 3300042602 | Ga0466713_022772 | Ga0466713_022772_11906_12706 | 266 |
| 115 | 3300042602 | Ga0466713_105089 | Ga0466713_105089_5433_6233 | 266 |
| 116 | 3300042643 | Ga0466704_515225 | Ga0466704_515225_522_1322 | 266 |
| 117 | 3300042656 | Ga0466732_343159 | Ga0466732_343159_155_955 | 266 |
| 118 | iso_pr_bacteria | 2940193328 | 2940194730 | 266 |
| 119 | iso_pr_bacteria | 2940336608 | 2940338007 | 266 |
| 120 | 3300042602 | Ga0466713_049915 | Ga0466713_049915_2654_3484 | 267 |
| 121 | 3300005309 | Ga0074306_1119219 | Ga0074306_11192192 | 268 |
| 122 | 3300042592 | Ga0466693_443344 | Ga0466693_443344_27_836 | 269 |
| 123 | 3300042654 | Ga0466725_037990 | Ga0466725_037990_10490_11332 | 280 |
| 124 | 3300042618 | Ga0466723_098234 | Ga0466723_098234_1816_2697 | 293 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00557 | Peptidase_M24 | Metallopeptidase family M24 | 12 | 237 | 0.89 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.88 | 0.93 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.