Protein Family IF08036

Metagenome Isolate
195 Members
51 Samples
177 Scaffolds
516.81 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_073899|Ga0466723_073899_5673_7385
Length
570 aa
Sequence
MKFALQNGKKAMQRLNQVLIWLEKYKYCLSKERRFHSQLIKFYLRSLFFITIMLDNDIKQQVQGIFAGLQAKYTLDASVPVLHENRKDFEDFLTDIASTSDNIDCKINDGTQLAFLLLKNGKETGIKFRGIPSGHEFSSLILAILNSDGQGKNIPDEALINSVKALKGKINLTTYVSLACTNCPDIVQALNLMALLNNNIKHEMVDGALYQDEAAALNIQAVPSVFADGQLLHAGKSDFGTLLEKLKSYYGSEIKTDKTETKSYDVIVTGGGPSGTAAAIYSARKGLKVAIITERTGGQVNDTVGIENLISVPYTTGKQLATQLKSHIQNYEIDLLEHRRVEKIADENNKKIIFTSTGERFTAESIIIATGANWRKLNVAGESEYIGRGVAFCPHCDGPFYKGKHVAVIGGGNSGIEAAIDLSGICSKVTVLEYADNIKADIVLQENAKSRKNLEIITGVQTTEVMGNGEKVTGIAIKYRNTDKEEIINLDGIFVQIGLAANSGIFKDYVKTNKAGEIEIDEHCRTNRRGIYAAGDVTNIPYKQIIISMGEGAKAALSAFEDHIRNFSAN

📊 Sample Types

Isolate 9.2%
Metagenome 90.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 28.6%
Unclassified 22.4%
Termitidae 12.2%
Termopsidae 8.2%
Rhinotermitidae 8.2%
Blattidae 6.1%
Formicidae 6.1%
Passalidae 6.1%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 186
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
2 3003178663 Psychrobacter fulvigenes KC-40 Isolate Unclassified
3 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
15 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
16 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
17 2841821538 Psychrobacter sp. YP14 Isolate Unclassified
18 2987037630 Oecophyllibacter saccharovorans Ha5 Isolate Formicidae
19 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
20 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
21 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
22 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
23 8012112996 Staphylococcus muscae ATCC 49910 Isolate
24 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
25 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
26 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
27 2837008993 Oecophyllibacter saccharovorans Ta1 Isolate Formicidae
28 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
29 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
30 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
31 2843073756 Oecophyllibacter saccharovorans Jb2 Isolate Formicidae
32 2987233858 Stutzerimonas stutzeri AR9-4 Isolate Unclassified
33 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
34 8112490586 Staphylococcus muscae CCM 4175 Isolate
35 2873597894 Erysipelothrix sp. HDW6B Isolate Unclassified
36 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
37 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
38 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
39 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
40 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
41 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
42 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
43 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
44 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
45 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
46 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
47 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
48 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
49 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
50 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
51 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_011389 3300042612 Bacteria 26149
2 Ga0466703_108464 3300042636 Bacteria 16019
3 Ga0466704_119378 3300042643 Bacteria 37210
4 Ga0466704_245786 3300042643 Bacteria 13765
5 Ga0466704_253317 3300042643 Bacteria 5002
6 Ga0466708_041079 3300042652 Bacteria 19149
7 Ga0466708_120069 3300042652 Bacteria 11945
8 Ga0466708_193294 3300042652 Bacteria 16352
9 Ga0466727_031563 3300042655 Bacteria 12423
10 Ga0466727_126115 3300042655 Bacteria 5777
11 Ga0466727_256051 3300042655 Bacteria 5473
12 Ga0466707_354973 3300042601 Bacteria 6540
13 Ga0466716_349846 3300042605 Bacteria 13854
14 Ga0466719_077234 3300042606 Unclassified 4198
15 Ga0466722_108389 3300042609 Bacteria 5696
16 Ga0466690_101169 3300042590 Bacteria 9511
17 Ga0466691_062864 3300042593 Bacteria 10343
18 Ga0466711_048732 3300042615 Bacteria 11043
19 Ga0466715_157210 3300042616 Bacteria 20490
20 Ga0466715_165454 3300042616 Bacteria 2920
21 Ga0466715_478390 3300042616 Bacteria 13908
22 Ga0466723_123513 3300042618 Bacteria 16564
23 2226983153 2225789003 Bacteria 9059
24 2227535714 2225789004 Bacteria 63282
25 Ga0466697_096879 3300042611 Bacteria 330838
26 Ga0466705_235933 3300042612 Bacteria 12959
27 Ga0466703_083585 3300042636 Bacteria 3342
28 Ga0466704_572823 3300042643 Bacteria 27731
29 Ga0466727_319003 3300042655 Bacteria 50861
30 Ga0466713_056121 3300042602 Bacteria 24333
31 Ga0466690_328021 3300042590 Bacteria 13115
32 Ga0466711_057542 3300042615 Bacteria 70908
33 Ga0466711_398346 3300042615 Bacteria 8484
34 Ga0466723_037591 3300042618 Bacteria 8313
35 Ga0466726_300195 3300042619 Unclassified 2201
36 IMNBL1DRAFT_c0005656 3300000062 Bacteria 7065
37 Ga0068302_10077873 3300005071 Bacteria 2450
38 Ga0068302_10098622 3300005071 Unclassified 7292
39 Ga0466709_264839 3300042648 Bacteria 9195
40 Ga0466708_154325 3300042652 Bacteria 6703
41 Ga0466725_037026 3300042654 Bacteria 49383
42 Ga0466727_277179 3300042655 Bacteria 2794
43 Ga0466706_078042 3300042599 Bacteria 3676
44 Ga0466706_079021 3300042599 Bacteria 1768
45 Ga0466713_133915 3300042602 Bacteria 7822
46 Ga0466716_183262 3300042605 Bacteria 30600
47 Ga0466716_225048 3300042605 Bacteria 4547
48 Ga0466719_133184 3300042606 Bacteria 4796
49 Ga0466719_147084 3300042606 Bacteria 7027
50 Ga0466719_175336 3300042606 Bacteria 6250
51 Ga0466690_177182 3300042590 Bacteria 15895
52 Ga0466690_368746 3300042590 Bacteria 9309
53 Ga0466711_403039 3300042615 Bacteria 15942
54 Ga0466715_434977 3300042616 Bacteria 19735
55 Ga0466729_097262 3300042621 Bacteria 61385
56 Ga0466705_247701 3300042612 Bacteria 13816
57 Ga0466705_281071 3300042612 Bacteria 4109
58 Ga0466705_306668 3300042612 Bacteria 5957
59 Ga0466733_165496 3300042659 Bacteria 147790
60 Ga0466703_268814 3300042636 Unclassified 6154
61 Ga0466704_148962 3300042643 Bacteria 2157
62 Ga0466709_020733 3300042648 Bacteria 48670
63 Ga0466709_219765 3300042648 Bacteria 5631
64 Ga0466725_072012 3300042654 Bacteria 51081
65 Ga0466727_034358 3300042655 Bacteria 33712
66 Ga0466727_187817 3300042655 Bacteria 5702
67 Ga0466727_240512 3300042655 Bacteria 3148
68 Ga0466707_192426 3300042601 Bacteria 6724
69 Ga0466719_326780 3300042606 Bacteria 6802
70 Ga0466690_153303 3300042590 Bacteria 2364
71 Ga0466690_186667 3300042590 Bacteria 2620
72 Ga0466692_197900 3300042591 Bacteria 10575
73 Ga0466691_055600 3300042593 Bacteria 8718
74 Ga0466705_431915 3300042612 Bacteria 29542
75 Ga0466723_016888 3300042618 Bacteria 10591
76 Ga0466723_123220 3300042618 Bacteria 4036
77 Ga0466729_297621 3300042621 Bacteria 12032
78 Ga0466735_029393 3300042624 Bacteria 3601
79 Ga0466735_121279 3300042624 Bacteria 3275
80 Ga0466735_167486 3300042624 Bacteria 3324
81 Ga0466703_243709 3300042636 Bacteria 10168
82 Ga0466704_100895 3300042643 Bacteria 39526
83 Ga0466704_161427 3300042643 Bacteria 11789
84 Ga0466708_406084 3300042652 Bacteria 3534
85 Ga0466727_293137 3300042655 Bacteria 3754
86 Ga0466727_329309 3300042655 Unclassified 3204
87 Ga0466706_178083 3300042599 Bacteria 37293
88 Ga0466716_004670 3300042605 Bacteria 1947
89 Ga0466716_462142 3300042605 Bacteria 4132
90 Ga0466719_143659 3300042606 Bacteria 4357
91 Ga0466722_020690 3300042609 Bacteria 3061
92 Ga0466722_136436 3300042609 Bacteria 9717
93 Ga0466722_136584 3300042609 Bacteria 2029
94 Ga0466657_255862 3300042582 Bacteria 22428
95 Ga0466690_136608 3300042590 Bacteria 6831
96 Ga0466690_184741 3300042590 Bacteria 23964
97 Ga0466691_216335 3300042593 Bacteria 4632
98 Ga0466696_245085 3300042596 Bacteria 5197
99 Ga0466712_201694 3300042614 Bacteria 4188
100 Ga0466715_101945 3300042616 Bacteria 16309
101 Ga0466715_599373 3300042616 Bacteria 3974
102 Ga0466723_118562 3300042618 Bacteria 10951
103 Ga0466723_162040 3300042618 Unclassified 6798
104 Ga0466726_325045 3300042619 Bacteria 2312
105 Ga0466728_328721 3300042620 Bacteria 8795
106 Ga0466728_390032 3300042620 Bacteria 10036
107 Ga0466704_127785 3300042643 Bacteria 3746
108 Ga0466709_064979 3300042648 Bacteria 2185
109 Ga0466708_084846 3300042652 Bacteria 3980
110 Ga0466708_136755 3300042652 Bacteria 42794
111 Ga0466727_117113 3300042655 Bacteria 3963
112 Ga0466727_171228 3300042655 Bacteria 14015
113 Ga0466706_008283 3300042599 Bacteria 3933
114 Ga0466706_272842 3300042599 Bacteria 6549
115 Ga0466707_320253 3300042601 Bacteria 5654
116 Ga0466692_187408 3300042591 Bacteria 16849
117 Ga0466691_191729 3300042593 Bacteria 4062
118 Ga0466696_130820 3300042596 Bacteria 2566
119 Ga0466696_295741 3300042596 Bacteria 16912
120 Ga0466696_488774 3300042596 Bacteria 20217
121 Ga0466711_026436 3300042615 Bacteria 12535
122 Ga0466711_188160 3300042615 Bacteria 36997
123 Ga0466711_271880 3300042615 Bacteria 44119
124 Ga0466723_116408 3300042618 Unclassified 13439
125 Ga0466729_176421 3300042621 Bacteria 18374
126 2227599623 2225789004 Bacteria 12562
127 Ga0466705_239968 3300042612 Bacteria 2656
128 Ga0466703_074575 3300042636 Bacteria 2439
129 Ga0466703_343602 3300042636 Bacteria 3598
130 Ga0466704_036280 3300042643 Bacteria 12387
131 Ga0466704_210346 3300042643 Bacteria 12652
132 Ga0466709_419096 3300042648 Bacteria 56162
133 Ga0466708_090546 3300042652 Bacteria 12205
134 Ga0466708_114657 3300042652 Bacteria 19666
135 Ga0466708_228583 3300042652 Bacteria 25073
136 Ga0466716_157882 3300042605 Bacteria 2772
137 Ga0466719_065640 3300042606 Bacteria 4129
138 Ga0466719_234023 3300042606 Bacteria 8613
139 Ga0466719_438760 3300042606 Bacteria 6175
140 Ga0466690_062044 3300042590 Bacteria 4269
141 Ga0466690_412796 3300042590 Bacteria 17631
142 Ga0466690_420451 3300042590 Bacteria 55352
143 Ga0466691_014851 3300042593 Bacteria 13862
144 Ga0466691_090120 3300042593 Bacteria 11302
145 Ga0466696_147532 3300042596 Bacteria 40988
146 Ga0466710_241070 3300042613 Bacteria 2796
147 Ga0466710_272501 3300042613 Bacteria 16412
148 Ga0466711_246769 3300042615 Bacteria 14917
149 Ga0466715_115534 3300042616 Bacteria 27264
150 Ga0466715_449728 3300042616 Bacteria 19735
151 Ga0466723_024450 3300042618 Bacteria 15240
152 Ga0466726_012664 3300042619 Bacteria 14117
153 Ga0466726_030060 3300042619 Bacteria 20392
154 Ga0466726_162837 3300042619 Bacteria 13744
155 Ga0466728_362743 3300042620 Bacteria 7089
156 Ga0466728_384672 3300042620 Bacteria 2886
157 IMNBL1DRAFT_c0007827 3300000062 Bacteria 5546
158 Ga0466705_226040 3300042612 Bacteria 8446
159 Ga0466703_202228 3300042636 Bacteria 12788
160 Ga0466704_278048 3300042643 Bacteria 35404
161 Ga0466709_352187 3300042648 Bacteria 16493
162 Ga0466708_337902 3300042652 Bacteria 34703
163 Ga0466706_003744 3300042599 Bacteria 5876
164 Ga0466707_039207 3300042601 Bacteria 20731
165 Ga0466707_230981 3300042601 Bacteria 5625
166 Ga0466719_289949 3300042606 Bacteria 14035
167 Ga0466722_074972 3300042609 Bacteria 4369
168 Ga0466690_036952 3300042590 Bacteria 8415
169 Ga0466691_041694 3300042593 Unclassified 4367
170 Ga0466691_065223 3300042593 Bacteria 5643
171 Ga0466711_458550 3300042615 Bacteria 5351
172 Ga0466715_099333 3300042616 Bacteria 3178
173 Ga0466715_152732 3300042616 Bacteria 63075
174 Ga0466723_073899 3300042618 Bacteria 12479
175 Ga0466723_313673 3300042618 Bacteria 69196
176 Ga0466726_012239 3300042619 Bacteria 5298
177 Ga0068302_10086200 3300005071 Unclassified 3959

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042612 Ga0466705_239968 Ga0466705_239968_439_1995 490
2 3300042590 Ga0466690_136608 Ga0466690_136608_5258_6811 492
3 3300042636 Ga0466703_108464 Ga0466703_108464_8768_10321 496
4 3300042655 Ga0466727_329309 Ga0466727_329309_624_2171 503
5 iso_pr_bacteria 2873597894 2873599909 503
6 3300042619 Ga0466726_012664 Ga0466726_012664_3906_5468 506
7 3300005071 Ga0068302_10098622 Ga0068302_100986225 507
8 iso_pr_bacteria 2917496769 2917496816 507
9 iso_pr_bacteria 8012112996 8012114435 507
10 iso_pr_bacteria 8112490586 8112491011 507
11 3300042599 Ga0466706_079021 Ga0466706_079021_213_1739 508
12 3300042655 Ga0466727_256051 Ga0466727_256051_602_2161 508
13 3300042609 Ga0466722_136584 Ga0466722_136584_63_1613 509
14 3300042618 Ga0466723_116408 Ga0466723_116408_6109_7668 509
15 3300042606 Ga0466719_234023 Ga0466719_234023_4341_5897 510
16 3300042636 Ga0466703_243709 Ga0466703_243709_7826_9358 510
17 iso_pr_bacteria 2997944163 2997946271 510
18 3300042615 Ga0466711_188160 Ga0466711_188160_32576_34135 511
19 3300042619 Ga0466726_300195 Ga0466726_300195_269_1819 511
20 3300042620 Ga0466728_328721 Ga0466728_328721_1487_3043 511
21 3300042652 Ga0466708_154325 Ga0466708_154325_1156_2694 512
22 3300042655 Ga0466727_293137 Ga0466727_293137_547_2136 512
23 3300042601 Ga0466707_039207 Ga0466707_039207_2320_3861 513
24 3300042602 Ga0466713_133915 Ga0466713_133915_983_2524 513
25 3300042624 Ga0466735_167486 Ga0466735_167486_134_1675 513
26 2225789004 2227535714 2228051522 514
27 3300042582 Ga0466657_255862 Ga0466657_255862_14744_16288 514
28 3300042590 Ga0466690_101169 Ga0466690_101169_7701_9245 514
29 3300042590 Ga0466690_186667 Ga0466690_186667_740_2284 514
30 3300042593 Ga0466691_041694 Ga0466691_041694_331_1875 514
31 3300042593 Ga0466691_090120 Ga0466691_090120_5912_7456 514
32 3300042593 Ga0466691_216335 Ga0466691_216335_2851_4395 514
33 3300042611 Ga0466697_096879 Ga0466697_096879_144139_145683 514
34 3300042612 Ga0466705_235933 Ga0466705_235933_9468_11012 514
35 3300042612 Ga0466705_306668 Ga0466705_306668_2193_3737 514
36 3300042613 Ga0466710_241070 Ga0466710_241070_770_2314 514
37 3300042616 Ga0466715_165454 Ga0466715_165454_146_1690 514
38 3300042618 Ga0466723_037591 Ga0466723_037591_5131_6675 514
39 3300042620 Ga0466728_362743 Ga0466728_362743_246_1790 514
40 3300042621 Ga0466729_176421 Ga0466729_176421_12700_14244 514
41 3300042655 Ga0466727_031563 Ga0466727_031563_10862_12406 514
42 3300042655 Ga0466727_126115 Ga0466727_126115_3469_5013 514
43 3300000062 IMNBL1DRAFT_c0007827 IMNBL1DRAFT_00078275 515
44 3300005071 Ga0068302_10077873 Ga0068302_100778732 515
45 3300042590 Ga0466690_036952 Ga0466690_036952_2841_4388 515
46 3300042590 Ga0466690_412796 Ga0466690_412796_12071_13618 515
47 3300042591 Ga0466692_187408 Ga0466692_187408_1671_3218 515
48 3300042596 Ga0466696_245085 Ga0466696_245085_1927_3474 515
49 3300042601 Ga0466707_192426 Ga0466707_192426_1833_3380 515
50 3300042601 Ga0466707_320253 Ga0466707_320253_3285_4832 515
51 3300042601 Ga0466707_354973 Ga0466707_354973_3524_5071 515
52 3300042606 Ga0466719_077234 Ga0466719_077234_1762_3309 515
53 3300042612 Ga0466705_226040 Ga0466705_226040_4848_6395 515
54 3300042615 Ga0466711_026436 Ga0466711_026436_7108_8655 515
55 3300042615 Ga0466711_403039 Ga0466711_403039_10970_12517 515
56 3300042616 Ga0466715_599373 Ga0466715_599373_342_1889 515
57 3300042618 Ga0466723_123220 Ga0466723_123220_421_1968 515
58 3300042618 Ga0466723_123513 Ga0466723_123513_14671_16218 515
59 3300042619 Ga0466726_030060 Ga0466726_030060_13000_14547 515
60 3300042636 Ga0466703_074575 Ga0466703_074575_702_2249 515
61 3300042636 Ga0466703_268814 Ga0466703_268814_3920_5467 515
62 3300042652 Ga0466708_090546 Ga0466708_090546_9710_11257 515
63 3300042655 Ga0466727_277179 Ga0466727_277179_710_2257 515
64 3300042655 Ga0466727_319003 Ga0466727_319003_38370_39917 515
65 3300042659 Ga0466733_165496 Ga0466733_165496_44834_46381 515
66 2225789003 2226983153 2227329253 516
67 2225789004 2227599623 2228164497 516
68 3300042590 Ga0466690_177182 Ga0466690_177182_13896_15446 516
69 3300042593 Ga0466691_191729 Ga0466691_191729_284_1834 516
70 3300042599 Ga0466706_008283 Ga0466706_008283_1315_2865 516
71 3300042605 Ga0466716_349846 Ga0466716_349846_152_1702 516
72 3300042606 Ga0466719_133184 Ga0466719_133184_761_2311 516
73 3300042606 Ga0466719_143659 Ga0466719_143659_59_1609 516
74 3300042606 Ga0466719_175336 Ga0466719_175336_350_1900 516
75 3300042609 Ga0466722_020690 Ga0466722_020690_1364_2914 516
76 3300042609 Ga0466722_136436 Ga0466722_136436_869_2419 516
77 3300042612 Ga0466705_431915 Ga0466705_431915_2097_3647 516
78 3300042615 Ga0466711_048732 Ga0466711_048732_8196_9746 516
79 3300042615 Ga0466711_057542 Ga0466711_057542_50603_52153 516
80 3300042615 Ga0466711_398346 Ga0466711_398346_2956_4506 516
81 3300042616 Ga0466715_115534 Ga0466715_115534_20377_21927 516
82 3300042618 Ga0466723_024450 Ga0466723_024450_11548_13098 516
83 3300042618 Ga0466723_118562 Ga0466723_118562_2461_4011 516
84 3300042619 Ga0466726_012239 Ga0466726_012239_187_1737 516
85 3300042619 Ga0466726_162837 Ga0466726_162837_11421_12971 516
86 3300042621 Ga0466729_297621 Ga0466729_297621_623_2173 516
87 3300042624 Ga0466735_029393 Ga0466735_029393_324_1874 516
88 3300042636 Ga0466703_083585 Ga0466703_083585_1523_3073 516
89 3300042643 Ga0466704_036280 Ga0466704_036280_5111_6661 516
90 3300042643 Ga0466704_100895 Ga0466704_100895_12054_13604 516
91 3300042643 Ga0466704_161427 Ga0466704_161427_2193_3743 516
92 3300042643 Ga0466704_253317 Ga0466704_253317_56_1606 516
93 3300042643 Ga0466704_278048 Ga0466704_278048_29744_31294 516
94 3300042648 Ga0466709_219765 Ga0466709_219765_4008_5558 516
95 3300042652 Ga0466708_041079 Ga0466708_041079_5433_6983 516
96 3300042652 Ga0466708_228583 Ga0466708_228583_15996_17546 516
97 3300042652 Ga0466708_337902 Ga0466708_337902_21504_23054 516
98 3300042655 Ga0466727_034358 Ga0466727_034358_4605_6155 516
99 3300042655 Ga0466727_187817 Ga0466727_187817_291_1841 516
100 3300042655 Ga0466727_240512 Ga0466727_240512_1536_3086 516
101 iso_pr_bacteria 2609459943 2610742979 516
102 iso_pr_bacteria 2830041218 2830043322 516
103 iso_pr_bacteria 2940209341 2940212399 516
104 3300005071 Ga0068302_10086200 Ga0068302_100862002 517
105 3300042590 Ga0466690_328021 Ga0466690_328021_3747_5300 517
106 3300042590 Ga0466690_368746 Ga0466690_368746_6307_7860 517
107 3300042590 Ga0466690_420451 Ga0466690_420451_40322_41875 517
108 3300042593 Ga0466691_055600 Ga0466691_055600_881_2434 517
109 3300042593 Ga0466691_062864 Ga0466691_062864_1037_2590 517
110 3300042596 Ga0466696_147532 Ga0466696_147532_39252_40805 517
111 3300042596 Ga0466696_295741 Ga0466696_295741_6537_8090 517
112 3300042599 Ga0466706_078042 Ga0466706_078042_74_1627 517
113 3300042602 Ga0466713_056121 Ga0466713_056121_11564_13117 517
114 3300042605 Ga0466716_225048 Ga0466716_225048_178_1731 517
115 3300042612 Ga0466705_247701 Ga0466705_247701_1873_3426 517
116 3300042612 Ga0466705_281071 Ga0466705_281071_727_2280 517
117 3300042616 Ga0466715_101945 Ga0466715_101945_10220_11773 517
118 3300042616 Ga0466715_157210 Ga0466715_157210_2321_3874 517
119 3300042616 Ga0466715_478390 Ga0466715_478390_5525_7078 517
120 3300042618 Ga0466723_162040 Ga0466723_162040_2489_4042 517
121 3300042618 Ga0466723_313673 Ga0466723_313673_18409_19962 517
122 3300042620 Ga0466728_384672 Ga0466728_384672_1149_2702 517
123 3300042643 Ga0466704_127785 Ga0466704_127785_221_1774 517
124 3300042643 Ga0466704_210346 Ga0466704_210346_6408_7961 517
125 3300042643 Ga0466704_245786 Ga0466704_245786_10954_12507 517
126 3300042643 Ga0466704_572823 Ga0466704_572823_2994_4547 517
127 3300042648 Ga0466709_020733 Ga0466709_020733_9276_10829 517
128 3300042648 Ga0466709_264839 Ga0466709_264839_6251_7804 517
129 3300042652 Ga0466708_084846 Ga0466708_084846_524_2077 517
130 3300042652 Ga0466708_193294 Ga0466708_193294_8346_9899 517
131 3300042655 Ga0466727_117113 Ga0466727_117113_2136_3689 517
132 iso_pr_bacteria 2940202316 2940205241 517
133 3300000062 IMNBL1DRAFT_c0005656 IMNBL1DRAFT_00056566 518
134 3300042590 Ga0466690_062044 Ga0466690_062044_1174_2730 518
135 3300042590 Ga0466690_153303 Ga0466690_153303_507_2063 518
136 3300042593 Ga0466691_065223 Ga0466691_065223_1354_2910 518
137 3300042596 Ga0466696_130820 Ga0466696_130820_752_2308 518
138 3300042601 Ga0466707_230981 Ga0466707_230981_2401_3957 518
139 3300042605 Ga0466716_183262 Ga0466716_183262_25086_26642 518
140 3300042605 Ga0466716_462142 Ga0466716_462142_1572_3128 518
141 3300042606 Ga0466719_065640 Ga0466719_065640_1207_2763 518
142 3300042606 Ga0466719_438760 Ga0466719_438760_2701_4257 518
143 3300042609 Ga0466722_074972 Ga0466722_074972_1941_3497 518
144 3300042609 Ga0466722_108389 Ga0466722_108389_1056_2612 518
145 3300042612 Ga0466705_011389 Ga0466705_011389_24083_25639 518
146 3300042614 Ga0466712_201694 Ga0466712_201694_1101_2657 518
147 3300042615 Ga0466711_271880 Ga0466711_271880_19935_21491 518
148 3300042616 Ga0466715_099333 Ga0466715_099333_1058_2614 518
149 3300042616 Ga0466715_434977 Ga0466715_434977_17554_19110 518
150 3300042616 Ga0466715_449728 Ga0466715_449728_11389_12945 518
151 3300042618 Ga0466723_016888 Ga0466723_016888_1219_2775 518
152 3300042636 Ga0466703_202228 Ga0466703_202228_5626_7182 518
153 3300042636 Ga0466703_343602 Ga0466703_343602_570_2126 518
154 3300042648 Ga0466709_064979 Ga0466709_064979_352_1908 518
155 3300042648 Ga0466709_352187 Ga0466709_352187_8788_10344 518
156 3300042648 Ga0466709_419096 Ga0466709_419096_18419_19975 518
157 3300042652 Ga0466708_120069 Ga0466708_120069_8451_10007 518
158 3300042652 Ga0466708_406084 Ga0466708_406084_488_2044 518
159 3300042655 Ga0466727_171228 Ga0466727_171228_2068_3624 518
160 3300042593 Ga0466691_014851 Ga0466691_014851_6955_8514 519
161 3300042599 Ga0466706_003744 Ga0466706_003744_3402_4961 519
162 3300042606 Ga0466719_326780 Ga0466719_326780_394_1953 519
163 3300042620 Ga0466728_390032 Ga0466728_390032_3501_5060 519
164 3300042621 Ga0466729_097262 Ga0466729_097262_21607_23166 519
165 3300042643 Ga0466704_148962 Ga0466704_148962_514_2073 519
166 3300042591 Ga0466692_197900 Ga0466692_197900_1221_2783 520
167 3300042599 Ga0466706_272842 Ga0466706_272842_3359_4921 520
168 3300042615 Ga0466711_458550 Ga0466711_458550_2002_3564 520
169 3300042624 Ga0466735_121279 Ga0466735_121279_1626_3188 520
170 3300042652 Ga0466708_114657 Ga0466708_114657_8902_10464 520
171 iso_pr_bacteria 2695420314 2695472746 520
172 iso_pr_bacteria 2987233858 2987235628 520
173 3300042613 Ga0466710_272501 Ga0466710_272501_12426_13991 521
174 3300042652 Ga0466708_136755 Ga0466708_136755_37659_39224 521
175 3300042599 Ga0466706_178083 Ga0466706_178083_30726_32294 522
176 3300042606 Ga0466719_289949 Ga0466719_289949_11021_12589 522
177 iso_pr_bacteria 2940195863 2940196287 522
178 3300042605 Ga0466716_157882 Ga0466716_157882_209_1780 523
179 3300042596 Ga0466696_488774 Ga0466696_488774_14331_15905 524
180 3300042605 Ga0466716_004670 Ga0466716_004670_267_1841 524
181 3300042619 Ga0466726_325045 Ga0466726_325045_211_1785 524
182 3300042590 Ga0466690_184741 Ga0466690_184741_145_1722 525
183 3300042654 Ga0466725_037026 Ga0466725_037026_34565_36142 525
184 3300042654 Ga0466725_072012 Ga0466725_072012_24938_26515 525
185 iso_pr_bacteria 3003178663 3003179190 525
186 iso_pr_bacteria 2841821538 2841823713 526
187 3300042606 Ga0466719_147084 Ga0466719_147084_1247_2833 528
188 iso_pr_bacteria 2837008993 2837009038 529
189 iso_pr_bacteria 2843073756 2843074981 529
190 iso_pr_bacteria 2987037630 2987038573 529
191 3300042616 Ga0466715_152732 Ga0466715_152732_40420_42012 530
192 iso_pr_bacteria 2528768159 2529055067 531
193 3300042615 Ga0466711_246769 Ga0466711_246769_13142_14770 542
194 3300042643 Ga0466704_119378 Ga0466704_119378_10448_12151 559
195 3300042618 Ga0466723_073899 Ga0466723_073899_5673_7385 570

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 405 478 0.94
PF01134 GIDA Glucose inhibited division protein A 265 297 0.92
PF13192 Thioredoxin_3 Thioredoxin domain 176 236 0.89
PF01946 Thi4 Thi4 family 259 295 0.86
PF12831 FAD_oxidored FAD dependent oxidoreductase 265 299 0.86
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 264 541 0.85
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 311 535 0.75

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF07992 GO:0016491 oxidoreductase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.