Protein Family IF08030

Metagenome Isolate
229 Members
73 Samples
206 Scaffolds
196.45 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_059043|Ga0466723_059043_2669_3364
Length
231 aa
Sequence
LHNYFFIPYFAPSNRKKLFAYKENITLTHQKLTVMKDLKLMSDEELVVAYAQGNNSAFDVLLSRHQSNVFSYIYFIVKNREQAEDIFQETFVKAIVTIKQGKYTETGRFRAWINRIAHNLIIDNYRQEKNGQTVSNDEYDVDLFNNHKLSEGTIEDEMVKSQILVDVKKLINCLPENQKEVLLLRYYQNLSFKEIADITGVSINTALGRMRYAILNMRRIAEKKKMILTMV

📊 Sample Types

Isolate 10.0%
Metagenome 90.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 30.1%
Kalotermitidae 19.2%
Blattidae 16.4%
Unclassified 13.7%
Rhinotermitidae 6.8%
Termopsidae 5.5%
Hydrophilidae 2.7%
Passalidae 2.7%
Hodotermitidae 1.4%
Tenebrionidae 1.4%

🌳 Taxonomy

Archaea 1
Bacteria 208
Eukaryota 0
Viruses 0
Unclassified 20

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
2 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
3 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
4 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
13 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
14 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
15 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
16 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
19 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
20 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
21 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
24 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
25 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
26 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
27 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
28 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
29 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
30 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
31 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
32 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
33 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
34 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
35 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
36 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
37 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
38 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
39 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
40 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
41 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
42 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
43 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
44 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
45 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
46 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
47 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
48 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
49 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
50 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
51 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
52 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
53 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
54 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
55 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
56 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
57 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
58 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
59 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
60 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
61 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
62 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
63 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
64 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
65 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
66 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
67 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
68 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
69 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
70 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
71 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
72 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
73 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466713_010027 3300042602 Bacteria 77850
2 Ga0466713_082334 3300042602 Bacteria 4434
3 Ga0466713_131581 3300042602 Bacteria 7311
4 Ga0466716_092980 3300042605 Bacteria 25359
5 Ga0466719_225067 3300042606 Bacteria 1252
6 Ga0466697_102718 3300042611 Bacteria 1059
7 Ga0466697_270300 3300042611 Bacteria 2178
8 Ga0123357_10054778 3300009784 Bacteria 5374
9 Ga0123356_12197431 3300010049 Bacteria 690
10 Ga0123354_10000146 3300010882 Bacteria 55170
11 Ga0123354_10060821 3300010882 Bacteria 5581
12 Ga0466711_365911 3300042615 Bacteria 1665
13 Ga0466715_150753 3300042616 Bacteria 6126
14 Ga0466723_059043 3300042618 Bacteria 8005
15 Ga0466726_015324 3300042619 Bacteria 2797
16 Ga0466726_100799 3300042619 Bacteria 9381
17 Ga0466729_019404 3300042621 Bacteria 2728
18 Ga0466656_083890 3300042550 Bacteria 3636
19 Ga0466691_018496 3300042593 Bacteria 17321
20 Ga0466694_358004 3300042594 Bacteria 5415
21 IMNBL1DRAFT_c0000467 3300000062 Bacteria 33813
22 JGI24699J35502_11134178 3300002509 Bacteria 45574
23 Ga0466735_155482 3300042624 Bacteria 3287
24 Ga0466703_059223 3300042636 Bacteria 3920
25 Ga0466703_099365 3300042636 Unclassified 2276
26 Ga0466703_403696 3300042636 Bacteria 12492
27 Ga0466704_061950 3300042643 Bacteria 5620
28 Ga0466704_419667 3300042643 Bacteria 19776
29 Ga0466701_083828 3300042598 Bacteria 7767
30 Ga0466706_111608 3300042599 Bacteria 1770
31 Ga0466707_161572 3300042601 Bacteria 5739
32 Ga0466707_257651 3300042601 Bacteria 4220
33 Ga0466707_331501 3300042601 Bacteria 4814
34 Ga0466713_008150 3300042602 Bacteria 5436
35 Ga0466722_204774 3300042609 Bacteria 2015
36 Ga0466698_356627 3300042610 Bacteria 3011
37 Ga0123357_10009396 3300009784 Bacteria 12348
38 Ga0123354_10008719 3300010882 Bacteria 15454
39 Ga0123354_10520577 3300010882 Unclassified 914
40 Ga0466705_448318 3300042612 Bacteria 8503
41 Ga0466726_407205 3300042619 Bacteria 2220
42 Ga0466728_046563 3300042620 Unclassified 1572
43 Ga0466690_087140 3300042590 Bacteria 6388
44 Ga0466696_447285 3300042596 Bacteria 2337
45 2227247442 2225789004 Bacteria 32559
46 IMNBL1DRAFT_c0000312 3300000062 Bacteria 41387
47 IMNBL1DRAFT_c0000586 3300000062 Bacteria 29366
48 JGI24696J40584_12959270 3300002834 Bacteria 4924
49 Ga0123357_10003467 3300009784 Bacteria 18109
50 Ga0466735_090852 3300042624 Bacteria 7986
51 Ga0466735_185957 3300042624 Bacteria 3626
52 Ga0466709_072115 3300042648 Bacteria 26950
53 Ga0466701_020840 3300042598 Bacteria 1495
54 Ga0466701_078947 3300042598 Bacteria 1023
55 Ga0466700_427425 3300042600 Bacteria 9107
56 Ga0466707_230323 3300042601 Bacteria 1113
57 Ga0466707_396793 3300042601 Bacteria 1066
58 Ga0466713_020418 3300042602 Bacteria 5002
59 Ga0466713_059657 3300042602 Bacteria 33008
60 Ga0466713_130834 3300042602 Bacteria 31381
61 Ga0466717_211963 3300042604 Bacteria 1334
62 Ga0466716_065427 3300042605 Bacteria 3618
63 Ga0466722_209366 3300042609 Bacteria 18982
64 Ga0123357_10004633 3300009784 Bacteria 16222
65 Ga0123357_10043906 3300009784 Bacteria 6070
66 Ga0123356_10775074 3300010049 Bacteria 1130
67 Ga0466710_205251 3300042613 Bacteria 1277
68 Ga0466715_420652 3300042616 Bacteria 12675
69 Ga0466726_126830 3300042619 Bacteria 3817
70 Ga0466726_225443 3300042619 Bacteria 1166
71 Ga0466690_276223 3300042590 Bacteria 213056
72 Ga0466693_071888 3300042592 Unclassified 1175
73 Ga0466693_451440 3300042592 Bacteria 1553
74 Ga0466691_038094 3300042593 Bacteria 2026
75 Ga0466695_347947 3300042595 Unclassified 1417
76 IMNBL1DRAFT_c0001732 3300000062 Bacteria 16014
77 Ga0068305_10102235 3300005083 Bacteria 10518
78 Ga0123357_10000359 3300009784 Bacteria 42994
79 Ga0466703_032030 3300042636 Unclassified 4064
80 Ga0466703_097685 3300042636 Unclassified 1419
81 Ga0466704_473619 3300042643 Bacteria 1607
82 Ga0466700_063913 3300042600 Bacteria 21421
83 Ga0466700_450890 3300042600 Bacteria 11921
84 Ga0466707_260043 3300042601 Bacteria 20986
85 Ga0466707_378076 3300042601 Bacteria 5242
86 Ga0466713_005558 3300042602 Bacteria 10134
87 Ga0466713_123707 3300042602 Bacteria 19996
88 Ga0466713_141674 3300042602 Bacteria 6891
89 Ga0466714_058811 3300042603 Bacteria 71979
90 Ga0466719_001774 3300042606 Bacteria 3280
91 Ga0123357_10022134 3300009784 Bacteria 8518
92 Ga0123357_10345836 3300009784 Bacteria 1430
93 Ga0466711_264721 3300042615 Bacteria 26624
94 Ga0466715_416650 3300042616 Bacteria 71840
95 Ga0466728_057961 3300042620 Bacteria 56835
96 Ga0466690_272494 3300042590 Bacteria 17538
97 Ga0466696_089692 3300042596 Bacteria 2131
98 2227250835 2225789004 Unclassified 1320
99 JGI24702J35022_10002729 3300002462 Bacteria 10706
100 JGI24696J40584_12956464 3300002834 Bacteria 3122
101 Ga0068305_10193747 3300005083 Bacteria 6190
102 Ga0466730_062067 3300042625 Archaea 3908
103 Ga0466703_020230 3300042636 Bacteria 2623
104 Ga0466703_137673 3300042636 Bacteria 7150
105 Ga0466704_267720 3300042643 Bacteria 30847
106 Ga0466708_123801 3300042652 Bacteria 4409
107 Ga0466707_226849 3300042601 Bacteria 6964
108 Ga0466714_117493 3300042603 Bacteria 34193
109 Ga0466719_554744 3300042606 Bacteria 3723
110 Ga0466733_024002 3300042659 Bacteria 39250
111 Ga0123357_10321123 3300009784 Bacteria 1529
112 Ga0123357_10641908 3300009784 Unclassified 791
113 Ga0123354_10000888 3300010882 Bacteria 33343
114 Ga0466726_171026 3300042619 Bacteria 1136
115 Ga0466690_164624 3300042590 Bacteria 7555
116 Ga0466692_150288 3300042591 Bacteria 38717
117 Ga0466691_000556 3300042593 Bacteria 3440
118 JGI24699J35502_11134212 3300002509 Bacteria 62331
119 JGI24696J40584_12956214 3300002834 Bacteria 3044
120 Ga0068305_10014183 3300005083 Bacteria 16096
121 Ga0466735_007206 3300042624 Bacteria 5114
122 Ga0466703_424276 3300042636 Bacteria 1580
123 Ga0466709_368131 3300042648 Bacteria 3001
124 Ga0466708_119023 3300042652 Bacteria 10074
125 Ga0466727_308966 3300042655 Bacteria 6238
126 Ga0466713_082373 3300042602 Bacteria 18425
127 Ga0466713_151406 3300042602 Bacteria 82944
128 Ga0466716_070279 3300042605 Bacteria 9715
129 Ga0466716_237081 3300042605 Bacteria 27405
130 Ga0466716_384199 3300042605 Bacteria 2810
131 Ga0466705_264453 3300042612 Bacteria 6349
132 Ga0466733_144100 3300042659 Bacteria 7844
133 Ga0562377_0004 3300056842 Bacteria 3525959
134 Ga0123357_10336640 3300009784 Unclassified 1466
135 Ga0123357_10497819 3300009784 Unclassified 1015
136 Ga0123355_10415259 3300009826 Bacteria 1724
137 Ga0123354_10030047 3300010882 Bacteria 8539
138 Ga0123354_10147880 3300010882 Bacteria 2865
139 Ga0466705_454122 3300042612 Unclassified 3846
140 Ga0466711_126406 3300042615 Bacteria 3441
141 Ga0466711_173885 3300042615 Bacteria 5019
142 Ga0466711_285081 3300042615 Bacteria 2178
143 Ga0466715_131055 3300042616 Bacteria 12854
144 Ga0466715_480866 3300042616 Bacteria 8346
145 Ga0466723_312779 3300042618 Bacteria 1547
146 Ga0466692_117229 3300042591 Bacteria 56912
147 Ga0466696_498445 3300042596 Bacteria 1485
148 IMNBL1DRAFT_c0110413 3300000062 Unclassified 731
149 JGI24702J35022_10002429 3300002462 Bacteria 11372
150 JGI24705J35276_12213936 3300002504 Bacteria 1942
151 Ga0466735_104657 3300042624 Unclassified 1739
152 Ga0466735_215355 3300042624 Bacteria 2617
153 Ga0466703_243974 3300042636 Bacteria 11125
154 Ga0466704_480099 3300042643 Bacteria 39129
155 Ga0466727_253174 3300042655 Bacteria 42635
156 Ga0466706_288578 3300042599 Bacteria 3779
157 Ga0466700_156007 3300042600 Bacteria 3527
158 Ga0466698_473215 3300042610 Bacteria 1755
159 Ga0466733_121483 3300042659 Bacteria 4576
160 Ga0123357_10091803 3300009784 Bacteria 3953
161 Ga0123354_10214606 3300010882 Unclassified 2066
162 Ga0123354_10341563 3300010882 Bacteria 1349
163 Ga0466711_174407 3300042615 Bacteria 2819
164 Ga0466715_123008 3300042616 Bacteria 31782
165 Ga0466726_145668 3300042619 Bacteria 14266
166 Ga0466728_087812 3300042620 Bacteria 65534
167 Ga0466728_399272 3300042620 Bacteria 209367
168 Ga0466690_185946 3300042590 Bacteria 26397
169 Ga0466691_001192 3300042593 Bacteria 6426
170 Ga0466696_461433 3300042596 Bacteria 6270
171 IMNBL1DRAFT_c0012639 3300000062 Bacteria 3846
172 Ga0068302_10224522 3300005071 Bacteria 4575
173 Ga0068305_10281506 3300005083 Unclassified 4700
174 Ga0466735_030720 3300042624 Bacteria 1450
175 Ga0466735_043297 3300042624 Bacteria 1055
176 Ga0466703_127806 3300042636 Bacteria 4299
177 Ga0466704_013664 3300042643 Bacteria 7799
178 Ga0466709_342148 3300042648 Bacteria 6030
179 Ga0466707_226348 3300042601 Bacteria 14698
180 Ga0466707_243405 3300042601 Bacteria 10754
181 Ga0466707_284550 3300042601 Bacteria 19742
182 Ga0466713_059535 3300042602 Bacteria 37029
183 Ga0466713_088875 3300042602 Bacteria 3681
184 Ga0466713_145264 3300042602 Bacteria 3152
185 Ga0466719_270472 3300042606 Bacteria 3433
186 Ga0466705_202542 3300042612 Bacteria 10741
187 Ga0123357_10025230 3300009784 Bacteria 8014
188 Ga0123357_10043808 3300009784 Bacteria 6077
189 Ga0123354_10111876 3300010882 Bacteria 3599
190 Ga0466710_304898 3300042613 Bacteria 1714
191 Ga0466715_147874 3300042616 Bacteria 8029
192 Ga0466690_054099 3300042590 Bacteria 2774
193 Ga0466692_005457 3300042591 Bacteria 6303
194 Ga0466692_017863 3300042591 Bacteria 23869
195 IMNBL1DRAFT_c0148185 3300000062 Bacteria 603
196 JGI24695J34938_10081971 3300002450 Bacteria 1332
197 JGI24702J35022_10177120 3300002462 Bacteria 1209
198 JGI24699J35502_11133898 3300002509 Bacteria 18539
199 Ga0466729_317409 3300042621 Unclassified 5548
200 Ga0466735_021399 3300042624 Bacteria 17324
201 Ga0466735_191953 3300042624 Unclassified 1374
202 Ga0466703_033574 3300042636 Bacteria 1408
203 Ga0466703_236109 3300042636 Bacteria 3049
204 Ga0466704_374770 3300042643 Unclassified 2351
205 Ga0466727_071993 3300042655 Bacteria 9088
206 Ga0466727_310899 3300042655 Unclassified 3668

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042596 Ga0466696_447285 Ga0466696_447285_23_619 184
2 3300042601 Ga0466707_243405 Ga0466707_243405_3167_3760 185
3 3300042596 Ga0466696_089692 Ga0466696_089692_426_998 190
4 3300042612 Ga0466705_454122 Ga0466705_454122_2825_3397 190
5 3300042643 Ga0466704_374770 Ga0466704_374770_1620_2192 190
6 3300000062 IMNBL1DRAFT_c0148185 IMNBL1DRAFT_01481851 191
7 3300042590 Ga0466690_054099 Ga0466690_054099_14_589 191
8 3300042591 Ga0466692_005457 Ga0466692_005457_4709_5284 191
9 3300042596 Ga0466696_461433 Ga0466696_461433_863_1438 191
10 3300042596 Ga0466696_498445 Ga0466696_498445_256_831 191
11 3300042598 Ga0466701_020840 Ga0466701_020840_73_648 191
12 3300042601 Ga0466707_284550 Ga0466707_284550_4022_4597 191
13 3300042605 Ga0466716_092980 Ga0466716_092980_11215_11808 191
14 3300042615 Ga0466711_126406 Ga0466711_126406_2480_3055 191
15 3300042616 Ga0466715_131055 Ga0466715_131055_5312_5887 191
16 3300042616 Ga0466715_147874 Ga0466715_147874_443_1018 191
17 3300042616 Ga0466715_416650 Ga0466715_416650_40587_41162 191
18 3300042616 Ga0466715_420652 Ga0466715_420652_9437_10012 191
19 3300042619 Ga0466726_100799 Ga0466726_100799_2450_3025 191
20 3300042619 Ga0466726_171026 Ga0466726_171026_269_844 191
21 3300042620 Ga0466728_057961 Ga0466728_057961_25434_26009 191
22 3300042624 Ga0466735_104657 Ga0466735_104657_1113_1688 191
23 3300042655 Ga0466727_253174 Ga0466727_253174_39496_40071 191
24 3300005083 Ga0068305_10281506 Ga0068305_102815064 192
25 3300042592 Ga0466693_071888 Ga0466693_071888_323_901 192
26 3300042595 Ga0466695_347947 Ga0466695_347947_514_1092 192
27 3300042620 Ga0466728_399272 Ga0466728_399272_79361_79939 192
28 3300005083 Ga0068305_10102235 Ga0068305_1010223510 193
29 3300042603 Ga0466714_058811 Ga0466714_058811_35804_36385 193
30 3300042604 Ga0466717_211963 Ga0466717_211963_316_900 194
31 3300042615 Ga0466711_264721 Ga0466711_264721_22309_22893 194
32 3300042643 Ga0466704_473619 Ga0466704_473619_932_1516 194
33 2225789004 2227250835 2227694011 195
34 3300042590 Ga0466690_087140 Ga0466690_087140_3540_4127 195
35 3300042616 Ga0466715_123008 Ga0466715_123008_26268_26855 195
36 3300042601 Ga0466707_257651 Ga0466707_257651_254_844 196
37 3300042602 Ga0466713_059535 Ga0466713_059535_27151_27741 196
38 3300042602 Ga0466713_123707 Ga0466713_123707_13647_14237 196
39 3300042602 Ga0466713_131581 Ga0466713_131581_6640_7230 196
40 3300042602 Ga0466713_145264 Ga0466713_145264_1168_1758 196
41 3300042602 Ga0466713_151406 Ga0466713_151406_32360_32950 196
42 3300042612 Ga0466705_264453 Ga0466705_264453_5272_5862 196
43 3300042615 Ga0466711_174407 Ga0466711_174407_1704_2294 196
44 3300042615 Ga0466711_285081 Ga0466711_285081_1485_2075 196
45 3300042625 Ga0466730_062067 Ga0466730_062067_1608_2198 196
46 3300042636 Ga0466703_424276 Ga0466703_424276_131_721 196
47 3300042659 Ga0466733_024002 Ga0466733_024002_26011_26601 196
48 3300042659 Ga0466733_121483 Ga0466733_121483_419_1009 196
49 3300042659 Ga0466733_144100 Ga0466733_144100_1887_2477 196
50 iso_pr_bacteria 2695420314 2695472219 196
51 iso_pr_bacteria 2910926975 2910929854 196
52 iso_pr_bacteria 2910942425 2910945342 196
53 iso_pr_bacteria 2940216256 2940217213 196
54 iso_pr_bacteria 2940244548 2940245088 196
55 iso_pr_bacteria 2940248789 2940249328 196
56 iso_pr_bacteria 2940253009 2940256258 196
57 iso_pr_bacteria 2940257232 2940257294 196
58 iso_pr_bacteria 8100166142 8100171124 196
59 2225789004 2227247442 2227688713 197
60 3300000062 IMNBL1DRAFT_c0110413 IMNBL1DRAFT_01104131 197
61 3300042550 Ga0466656_083890 Ga0466656_083890_2405_2998 197
62 3300042590 Ga0466690_164624 Ga0466690_164624_1918_2511 197
63 3300042590 Ga0466690_185946 Ga0466690_185946_5441_6034 197
64 3300042590 Ga0466690_272494 Ga0466690_272494_13328_13921 197
65 3300042590 Ga0466690_276223 Ga0466690_276223_5948_6541 197
66 3300042591 Ga0466692_017863 Ga0466692_017863_19086_19679 197
67 3300042591 Ga0466692_117229 Ga0466692_117229_37194_37787 197
68 3300042591 Ga0466692_150288 Ga0466692_150288_6848_7441 197
69 3300042592 Ga0466693_451440 Ga0466693_451440_762_1355 197
70 3300042593 Ga0466691_000556 Ga0466691_000556_721_1314 197
71 3300042593 Ga0466691_001192 Ga0466691_001192_3217_3810 197
72 3300042593 Ga0466691_018496 Ga0466691_018496_1103_1696 197
73 3300042593 Ga0466691_038094 Ga0466691_038094_1098_1691 197
74 3300042594 Ga0466694_358004 Ga0466694_358004_256_849 197
75 3300042598 Ga0466701_078947 Ga0466701_078947_115_708 197
76 3300042598 Ga0466701_083828 Ga0466701_083828_4908_5501 197
77 3300042599 Ga0466706_111608 Ga0466706_111608_969_1562 197
78 3300042600 Ga0466700_063913 Ga0466700_063913_17315_17908 197
79 3300042600 Ga0466700_156007 Ga0466700_156007_1090_1683 197
80 3300042600 Ga0466700_427425 Ga0466700_427425_625_1218 197
81 3300042600 Ga0466700_450890 Ga0466700_450890_5221_5814 197
82 3300042601 Ga0466707_161572 Ga0466707_161572_3682_4275 197
83 3300042601 Ga0466707_226348 Ga0466707_226348_838_1431 197
84 3300042601 Ga0466707_226849 Ga0466707_226849_6001_6594 197
85 3300042601 Ga0466707_230323 Ga0466707_230323_26_619 197
86 3300042601 Ga0466707_260043 Ga0466707_260043_13165_13758 197
87 3300042601 Ga0466707_331501 Ga0466707_331501_693_1286 197
88 3300042601 Ga0466707_378076 Ga0466707_378076_2465_3058 197
89 3300042601 Ga0466707_396793 Ga0466707_396793_345_938 197
90 3300042602 Ga0466713_005558 Ga0466713_005558_3437_4030 197
91 3300042602 Ga0466713_008150 Ga0466713_008150_4179_4772 197
92 3300042602 Ga0466713_010027 Ga0466713_010027_27408_28001 197
93 3300042602 Ga0466713_020418 Ga0466713_020418_753_1346 197
94 3300042602 Ga0466713_059657 Ga0466713_059657_25102_25695 197
95 3300042602 Ga0466713_082334 Ga0466713_082334_2868_3461 197
96 3300042602 Ga0466713_082373 Ga0466713_082373_8785_9378 197
97 3300042602 Ga0466713_088875 Ga0466713_088875_2719_3312 197
98 3300042602 Ga0466713_130834 Ga0466713_130834_15312_15905 197
99 3300042602 Ga0466713_141674 Ga0466713_141674_5061_5654 197
100 3300042605 Ga0466716_065427 Ga0466716_065427_525_1118 197
101 3300042605 Ga0466716_070279 Ga0466716_070279_5424_6017 197
102 3300042605 Ga0466716_237081 Ga0466716_237081_2694_3287 197
103 3300042605 Ga0466716_384199 Ga0466716_384199_201_794 197
104 3300042606 Ga0466719_001774 Ga0466719_001774_668_1261 197
105 3300042606 Ga0466719_225067 Ga0466719_225067_163_756 197
106 3300042606 Ga0466719_270472 Ga0466719_270472_205_798 197
107 3300042606 Ga0466719_554744 Ga0466719_554744_1816_2409 197
108 3300042609 Ga0466722_204774 Ga0466722_204774_43_636 197
109 3300042609 Ga0466722_209366 Ga0466722_209366_17010_17603 197
110 3300042610 Ga0466698_356627 Ga0466698_356627_1469_2062 197
111 3300042610 Ga0466698_473215 Ga0466698_473215_391_984 197
112 3300042611 Ga0466697_102718 Ga0466697_102718_322_915 197
113 3300042611 Ga0466697_270300 Ga0466697_270300_224_817 197
114 3300042612 Ga0466705_202542 Ga0466705_202542_5750_6343 197
115 3300042612 Ga0466705_448318 Ga0466705_448318_4998_5591 197
116 3300042613 Ga0466710_205251 Ga0466710_205251_377_970 197
117 3300042613 Ga0466710_304898 Ga0466710_304898_103_696 197
118 3300042615 Ga0466711_173885 Ga0466711_173885_15_608 197
119 3300042615 Ga0466711_365911 Ga0466711_365911_306_899 197
120 3300042616 Ga0466715_150753 Ga0466715_150753_436_1029 197
121 3300042616 Ga0466715_480866 Ga0466715_480866_4048_4641 197
122 3300042618 Ga0466723_312779 Ga0466723_312779_270_863 197
123 3300042619 Ga0466726_015324 Ga0466726_015324_1699_2292 197
124 3300042619 Ga0466726_126830 Ga0466726_126830_1037_1630 197
125 3300042619 Ga0466726_145668 Ga0466726_145668_8124_8717 197
126 3300042619 Ga0466726_225443 Ga0466726_225443_410_1003 197
127 3300042619 Ga0466726_407205 Ga0466726_407205_1091_1684 197
128 3300042620 Ga0466728_046563 Ga0466728_046563_43_636 197
129 3300042620 Ga0466728_087812 Ga0466728_087812_38734_39327 197
130 3300042621 Ga0466729_019404 Ga0466729_019404_686_1279 197
131 3300042621 Ga0466729_317409 Ga0466729_317409_774_1367 197
132 3300042624 Ga0466735_007206 Ga0466735_007206_4493_5086 197
133 3300042624 Ga0466735_021399 Ga0466735_021399_15476_16069 197
134 3300042624 Ga0466735_030720 Ga0466735_030720_651_1244 197
135 3300042624 Ga0466735_043297 Ga0466735_043297_309_902 197
136 3300042624 Ga0466735_090852 Ga0466735_090852_6519_7112 197
137 3300042624 Ga0466735_155482 Ga0466735_155482_1410_2003 197
138 3300042624 Ga0466735_185957 Ga0466735_185957_1635_2228 197
139 3300042624 Ga0466735_191953 Ga0466735_191953_433_1026 197
140 3300042624 Ga0466735_215355 Ga0466735_215355_810_1403 197
141 3300042636 Ga0466703_020230 Ga0466703_020230_1014_1607 197
142 3300042636 Ga0466703_032030 Ga0466703_032030_1214_1807 197
143 3300042636 Ga0466703_033574 Ga0466703_033574_19_612 197
144 3300042636 Ga0466703_059223 Ga0466703_059223_2909_3502 197
145 3300042636 Ga0466703_097685 Ga0466703_097685_399_992 197
146 3300042636 Ga0466703_099365 Ga0466703_099365_1201_1794 197
147 3300042636 Ga0466703_127806 Ga0466703_127806_2670_3263 197
148 3300042636 Ga0466703_137673 Ga0466703_137673_408_1001 197
149 3300042636 Ga0466703_236109 Ga0466703_236109_622_1215 197
150 3300042636 Ga0466703_243974 Ga0466703_243974_818_1411 197
151 3300042636 Ga0466703_403696 Ga0466703_403696_7399_7992 197
152 3300042643 Ga0466704_013664 Ga0466704_013664_4598_5191 197
153 3300042643 Ga0466704_061950 Ga0466704_061950_4587_5180 197
154 3300042643 Ga0466704_267720 Ga0466704_267720_24478_25071 197
155 3300042643 Ga0466704_419667 Ga0466704_419667_10810_11403 197
156 3300042643 Ga0466704_480099 Ga0466704_480099_4538_5131 197
157 3300042648 Ga0466709_072115 Ga0466709_072115_22776_23369 197
158 3300042648 Ga0466709_342148 Ga0466709_342148_4333_4926 197
159 3300042648 Ga0466709_368131 Ga0466709_368131_710_1303 197
160 3300042652 Ga0466708_119023 Ga0466708_119023_3122_3715 197
161 3300042652 Ga0466708_123801 Ga0466708_123801_1322_1915 197
162 3300042655 Ga0466727_071993 Ga0466727_071993_3265_3858 197
163 3300042655 Ga0466727_308966 Ga0466727_308966_5369_5962 197
164 3300042655 Ga0466727_310899 Ga0466727_310899_530_1123 197
165 3300056842 Ga0562377_0004 Ga0562377_0004_2265267_2265860 197
166 iso_pr_bacteria 2695420317 2695485544 197
167 iso_pr_bacteria 2820757377 2820758061 197
168 iso_pr_bacteria 2820759988 2820761155 197
169 iso_pr_bacteria 2820762746 2820764599 197
170 iso_pr_bacteria 2820778767 2820781264 197
171 iso_pr_bacteria 2873600114 2873600860 197
172 iso_pr_bacteria 2873610414 2873611179 197
173 iso_pr_bacteria 2910930387 2910931221 197
174 iso_pr_bacteria 2910959314 2910959718 197
175 iso_pr_bacteria 2940193328 2940195741 197
176 iso_pr_bacteria 2940336608 2940339011 197
177 iso_pr_bacteria 2967483437 2967483903 197
178 iso_pr_bacteria 8100157865 8100160777 197
179 3300000062 IMNBL1DRAFT_c0000312 IMNBL1DRAFT_000031230 198
180 3300000062 IMNBL1DRAFT_c0000467 IMNBL1DRAFT_000046727 198
181 3300000062 IMNBL1DRAFT_c0000586 IMNBL1DRAFT_000058611 198
182 3300000062 IMNBL1DRAFT_c0001732 IMNBL1DRAFT_000173212 198
183 3300000062 IMNBL1DRAFT_c0012639 IMNBL1DRAFT_00126392 198
184 3300002450 JGI24695J34938_10081971 JGI24695J34938_100819712 198
185 3300002462 JGI24702J35022_10002429 JGI24702J35022_100024295 198
186 3300002462 JGI24702J35022_10002729 JGI24702J35022_100027294 198
187 3300002504 JGI24705J35276_12213936 JGI24705J35276_122139361 198
188 3300002509 JGI24699J35502_11133898 JGI24699J35502_1113389819 198
189 3300002509 JGI24699J35502_11134178 JGI24699J35502_1113417816 198
190 3300002509 JGI24699J35502_11134212 JGI24699J35502_1113421217 198
191 3300002834 JGI24696J40584_12956214 JGI24696J40584_129562144 198
192 3300002834 JGI24696J40584_12956464 JGI24696J40584_129564643 198
193 3300002834 JGI24696J40584_12959270 JGI24696J40584_129592704 198
194 3300005071 Ga0068302_10224522 Ga0068302_102245225 198
195 3300005083 Ga0068305_10014183 Ga0068305_1001418315 198
196 3300005083 Ga0068305_10193747 Ga0068305_101937473 198
197 3300009784 Ga0123357_10000359 Ga0123357_1000035915 198
198 3300009784 Ga0123357_10003467 Ga0123357_1000346713 198
199 3300009784 Ga0123357_10004633 Ga0123357_1000463310 198
200 3300009784 Ga0123357_10009396 Ga0123357_100093966 198
201 3300009784 Ga0123357_10022134 Ga0123357_100221345 198
202 3300009784 Ga0123357_10025230 Ga0123357_100252307 198
203 3300009784 Ga0123357_10043808 Ga0123357_100438084 198
204 3300009784 Ga0123357_10043906 Ga0123357_100439069 198
205 3300009784 Ga0123357_10054778 Ga0123357_100547783 198
206 3300009784 Ga0123357_10091803 Ga0123357_100918033 198
207 3300009784 Ga0123357_10321123 Ga0123357_103211232 198
208 3300009784 Ga0123357_10336640 Ga0123357_103366401 198
209 3300009784 Ga0123357_10345836 Ga0123357_103458362 198
210 3300009784 Ga0123357_10497819 Ga0123357_104978191 198
211 3300009784 Ga0123357_10641908 Ga0123357_106419081 198
212 3300009826 Ga0123355_10415259 Ga0123355_104152591 198
213 3300010049 Ga0123356_10775074 Ga0123356_107750742 198
214 3300010882 Ga0123354_10000146 Ga0123354_1000014632 198
215 3300010882 Ga0123354_10000888 Ga0123354_1000088815 198
216 3300010882 Ga0123354_10008719 Ga0123354_100087193 198
217 3300010882 Ga0123354_10030047 Ga0123354_100300472 198
218 3300010882 Ga0123354_10060821 Ga0123354_100608213 198
219 3300010882 Ga0123354_10111876 Ga0123354_101118765 198
220 3300010882 Ga0123354_10147880 Ga0123354_101478801 198
221 3300010882 Ga0123354_10214606 Ga0123354_102146063 198
222 3300010882 Ga0123354_10341563 Ga0123354_103415631 198
223 3300010882 Ga0123354_10520577 Ga0123354_105205771 198
224 iso_pr_bacteria 2910949487 2910950644 198
225 3300002462 JGI24702J35022_10177120 JGI24702J35022_101771203 199
226 3300042599 Ga0466706_288578 Ga0466706_288578_1183_1782 199
227 3300010049 Ga0123356_12197431 Ga0123356_121974311 200
228 3300042603 Ga0466714_117493 Ga0466714_117493_7769_8386 205
229 3300042618 Ga0466723_059043 Ga0466723_059043_2669_3364 231

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04545 Sigma70_r4 Sigma-70, region 4 171 218 0.95
PF08281 Sigma70_r4_2 Sigma-70, region 4 167 205 0.94
PF04542 Sigma70_r2 Sigma-70 region 2 61 129 0.91

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.45 0.53 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.