Protein Family IF08016

Metagenome Isolate
301 Members
152 Samples
190 Scaffolds
333.15 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_038135|Ga0466723_038135_2268_3410
Length
380 aa
Sequence
MLPYKRKERSLPEGDTAAISSCNAPTESPAGQEMKTMEKPLIAVPAGDPAGIGPEILVKAFADSAVRQTARCVAVGGREVIENAVAMTGLPLEVKPLRNVGDGDFSEGVLNLVPVDGVAGTKVIDKGAFRYGVVNAECGRAAFRYIEKSIELALAKKVDAVATTPVNKESLQAGGVPYIGHTEIFAGLTGTNDPLTVFEVRGMRIFFLSRHVSLRKACDLVQKDRIVDYVKRAFTVLRQFGVTQGSMAVAGLNPHSGEHGLFGDEEVNEVAPAVAALKAQGYPVEGPIGADSVFHLALQGKYNSVLSLYHDQGHIAAKTLDFEKTISLTGGMPILRTSVDHGTAFDIAGKNLASPVSMIEAIVLAAKYAPAFRVALDPQN

📊 Sample Types

Isolate 36.9%
Metagenome 63.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Apidae 25.7%
Unclassified 20.3%
Termitidae 11.5%
Kalotermitidae 8.8%
Tenebrionidae 6.8%
Curculionidae 4.1%
Blattidae 2.7%
Termopsidae 2.7%
Rhinotermitidae 2.0%
Culicidae 2.0%
Passalidae 1.4%
Scarabaeidae 1.4%
Drosophilidae 1.4%
Cerambycidae 1.4%
Formicidae 1.4%
Pentatomidae 0.7%
Rhopalidae 0.7%
Carabidae 0.7%
Plutellidae 0.7%
Crambidae 0.7%
Armadillidiidae 0.7%
Anthocoridae 0.7%
Pteromalidae 0.7%
Tephritidae 0.7%
Thripidae 0.7%

🌳 Taxonomy

Archaea 1
Bacteria 276
Eukaryota 0
Viruses 0
Unclassified 24

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2189573031 Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. Metagenome Apidae
2 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
3 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
4 2820371985 Unclassified Firmicutes Nt197P3bin100 Isolate Unclassified
5 2820455747 Unclassified Firmicutes Lab288P3bin160 Isolate Unclassified
6 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
7 2846472545 Gilliamella sp. N-W3 Isolate Apidae
8 2846493360 Gilliamella apis N-G1 Isolate Apidae
9 2861449170 Desulfovibrio intestinalis DSM 11275 Isolate Unclassified
10 2870908367 Gilliamella apis NO13 Isolate Apidae
11 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
12 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
13 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
14 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Plutellidae
15 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
16 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
17 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
18 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
19 2756170277 Enterobacillus tribolii DSM 103736 Isolate Unclassified
20 2785510744 Gilliamella sp. ESL0405 Isolate Apidae
21 2785510745 Gilliamella sp. ESL0407 Isolate Apidae
22 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
23 2846490831 Gilliamella apis ESL0172 Isolate Apidae
24 2854129949 Gilliamella apis M1-2G Isolate Apidae
25 2868486652 Gilliamella sp. N-G2 Isolate Apidae
26 2870900452 Gilliamella apis NO14 Isolate Apidae
27 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
28 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
29 2978102237 Serratia fonticola AeS1 Isolate Culicidae
30 3007994558 Escherichia alba B35 Isolate Tenebrionidae
31 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
32 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
33 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
34 2511231129 Vibrio sp. EJY3 Isolate Unclassified
35 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
36 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
37 2651870110 Izhakiella capsodis N6PO6 Isolate Unclassified
38 2834098943 Gilliamella apis NO3 Isolate Apidae
39 2846480698 Gilliamella apis N-G4 Isolate Apidae
40 2857881114 Gilliamella apis N-G3 Isolate Apidae
41 2868494745 Gilliamella apis NO1 Isolate Apidae
42 2870915472 Gilliamella apis A-TSA3 Isolate Apidae
43 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
44 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
45 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
46 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
47 648276708 Pantoea sp. aB Isolate Unclassified
48 8001394582 Limnobaculum allomyrinae BWR-B9 Isolate Scarabaeidae
49 8088486376 Gilliamella apis ESL0172 Isolate Apidae
50 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
51 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
52 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
53 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
54 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
55 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
56 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
57 2648501158 Vibrio hepatarius DSM 19134 Isolate Unclassified
58 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
59 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
60 2854147632 Gilliamella apicola wkB195 Isolate Apidae
61 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
62 2870913170 Gilliamella apis A-TSA2 Isolate Apidae
63 2870920129 Gilliamella apicola wkB108 Isolate Apidae
64 2873638493 Gilliamella apicola wkB72 Isolate Apidae
65 2876025319 Gilliamella apis NO12 Isolate Apidae
66 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
67 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
68 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
69 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
70 8088493931 Gilliamella apis K-MP18 Isolate Apidae
71 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
72 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
73 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
74 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
75 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
76 2684622924 Gilliamella apicola Ga_177 Isolate Unclassified
77 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
78 2820159668 Unclassified Proteobacteria Cu122P3bin5 Isolate Unclassified
79 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
80 2857868033 Gilliamella apis P62G Isolate Apidae
81 2868497104 Gilliamella apis A-TSA4 Isolate Apidae
82 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
83 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
84 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
85 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
86 8088488961 Gilliamella apis ESL0169 Isolate Apidae
87 8099192374 Erwinia typographi IC4 Isolate Curculionidae
88 8110023836 Enterobacterales bacterium BIT-L3 Isolate Tenebrionidae
89 3000861951 Budvicia diplopodorum D9 Isolate
90 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
91 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
92 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
93 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
94 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
95 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
96 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
97 2531839602 Shimwellia blattae NBRC 105725 Isolate Unclassified
98 2684622923 Gilliamella apicola Ga_172 Isolate Unclassified
99 2684622926 Gilliamella apicola Ga_182 Isolate Unclassified
100 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
101 2846483029 Gilliamella apis AM1 Isolate Apidae
102 2849466174 Gilliamella apis P83G Isolate Apidae
103 2854149989 Gilliamella apis A-TSA1 Isolate Apidae
104 2876019154 Gilliamella apicola ESL0182 Isolate Apidae
105 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
106 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
107 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
108 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
109 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
110 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
111 3300000461 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-P17 Metagenome Apidae
112 3300000490 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 Metagenome Apidae
113 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
114 3300005309 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut Metagenome Drosophilidae
115 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
116 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
117 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
118 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
119 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
120 2513020017 Shimwellia blattae DSM 4481 Isolate Unclassified
121 2684622922 Gilliamella apicola Ga_169 Isolate Unclassified
122 2706794701 Opitutaceae bacterium TSB47 Isolate Rhinotermitidae
123 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
124 2820094617 Unclassified Proteobacteria Lab288P3bin216 Isolate Unclassified
125 2836714267 Shimwellia blattae NCTC10965 Isolate
126 2837615801 Gilliamella apicola ESL0177 Isolate Apidae
127 2873643457 Gilliamella apis A-4-12 Isolate Apidae
128 2876011797 Gilliamella apis NO16 Isolate Apidae
129 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
130 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
131 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
132 8103002986 Erwinia sp. S38 Isolate Curculionidae
133 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
134 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
135 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
136 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
137 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
138 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
139 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
140 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
141 2868504459 Gilliamella apis NO4 Isolate Apidae
142 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
143 2878464769 Gilliamella apis ESL0169 Isolate Apidae
144 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
145 8001059720 Tenebrionicola larvae YMB-R22 Isolate Tenebrionidae
146 8102982778 Erwinia sp. S63 Isolate Curculionidae
147 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
148 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
149 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
150 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
151 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
152 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_162037 3300042612 Bacteria 14503
2 Ga0562375_2497 3300056856 Unclassified 20407
3 Ga0562376_0114 3300056857 Bacteria 182735
4 Ga0562376_6620 3300056857 Unclassified 3101
5 Ga0160468_100719 3300012819 Bacteria 11293
6 Ga0466690_246690 3300042590 Bacteria 1907
7 Ga0466691_141508 3300042593 Bacteria 7972
8 Ga0466713_044710 3300042602 Unclassified 1933
9 Ga0123357_10006606 3300009784 Bacteria 14195
10 Ga0123356_10018153 3300010049 Unclassified 6681
11 gam1t_NODE_696420_length=26318_GC=34_2_Contigs=5 2189573031 Unclassified 26358
12 HBC_ctgsDRAFT_1000384 3300000333 Bacteria 10172
13 JGI24695J34938_10000531 3300002450 Bacteria 36996
14 Ga0074278_122865 3300005721 Bacteria 27496
15 Ga0466711_105497 3300042615 Bacteria 2953
16 Ga0466723_279878 3300042618 Bacteria 1978
17 Ga0466728_025508 3300042620 Bacteria 5410
18 Ga0466704_069926 3300042643 Bacteria 7528
19 Ga0562378_0959 3300056814 Bacteria 36878
20 Ga0562376_0552 3300056857 Unclassified 65834
21 Ga0466713_106089 3300042602 Bacteria 6037
22 Ga0466716_170472 3300042605 Bacteria 3228
23 Ga0466719_284512 3300042606 Bacteria 2774
24 Ga0466722_095444 3300042609 Bacteria 2258
25 Ga0123355_10003156 3300009826 Bacteria 23518
26 Ga0123355_10199336 3300009826 Bacteria 2928
27 HBC_ctgsDRAFT_1019526 3300000333 Unclassified 1653
28 Ga0466710_069453 3300042613 Bacteria 1205
29 Ga0466711_201761 3300042615 Bacteria 2110
30 Ga0466711_366268 3300042615 Bacteria 22616
31 Ga0466726_316125 3300042619 Bacteria 1440
32 Ga0466735_104670 3300042624 Bacteria 1913
33 Ga0466704_410129 3300042643 Bacteria 2893
34 Ga0466709_186893 3300042648 Bacteria 9141
35 Ga0466705_082857 3300042612 Bacteria 3819
36 Ga0466705_114831 3300042612 Bacteria 2329
37 Ga0562379_0121 3300056790 Bacteria 248675
38 Ga0562378_0178 3300056814 Bacteria 159188
39 Ga0562378_1579 3300056814 Bacteria 23922
40 Ga0562377_0002 3300056842 Bacteria 4351833
41 Ga0562375_0175 3300056856 Bacteria 188123
42 Ga0562375_0484 3300056856 Unclassified 82588
43 Ga0562376_1548 3300056857 Unclassified 31662
44 Ga0160436_1002319 3300012861 Bacteria 4872
45 Ga0247289_0176 3300035363 Bacteria 14969
46 Ga0466691_057832 3300042593 Unclassified 15562
47 Ga0466695_394366 3300042595 Bacteria 1637
48 Ga0466707_080345 3300042601 Bacteria 1732
49 Ga0466713_022509 3300042602 Bacteria 91675
50 Ga0466714_150037 3300042603 Bacteria 1163
51 Ga0466716_076684 3300042605 Bacteria 1586
52 Ga0466722_237021 3300042609 Bacteria 3791
53 Ga0466698_039014 3300042610 Bacteria 10375
54 Ga0123353_10124369 3300010167 Bacteria 4145
55 gam1t_NODE_551252_length=27406_GC=35_3_Contigs=10 2189573031 Bacteria 27496
56 HBC_ctgsDRAFT_1024013 3300000333 Bacteria 1494
57 SCG598L16_106705 3300000490 Unclassified 27442
58 Meta3P_1000402 3300002464 Bacteria 34913
59 CVPL010L_1000044 3300002932 Bacteria 41456
60 Ga0074278_133768 3300005721 Bacteria 26358
61 Ga0074278_135759 3300005721 Unclassified 15548
62 Ga0123357_10000006 3300009784 Bacteria 279835
63 Ga0466705_475624 3300042612 Bacteria 1824
64 Ga0466726_291624 3300042619 Bacteria 11904
65 Ga0466735_107263 3300042624 Bacteria 2315
66 Ga0466703_044165 3300042636 Bacteria 4674
67 Ga0466704_492471 3300042643 Bacteria 2484
68 Ga0466727_067342 3300042655 Bacteria 1324
69 Ga0466705_345925 3300042612 Bacteria 4480
70 Ga0466733_093811 3300042659 Bacteria 2133
71 Ga0562375_0173 3300056856 Bacteria 189818
72 Ga0264413_136588 3300024493 Bacteria 4426
73 Ga0415639_066612 3300038395 Bacteria 5566
74 Ga0466690_416171 3300042590 Bacteria 2229
75 Ga0466713_096430 3300042602 Bacteria 298472
76 Ga0466713_150318 3300042602 Bacteria 4086
77 Ga0466722_045596 3300042609 Archaea 4072
78 Ga0466722_236646 3300042609 Bacteria 5911
79 Ga0466722_266675 3300042609 Bacteria 1631
80 Ga0123355_10002379 3300009826 Bacteria 26608
81 Ga0123356_10439167 3300010049 Bacteria 1451
82 FGTW_contig30406 2065487013 Bacteria 104687
83 JGI24695J34938_10012599 3300002450 Bacteria 4474
84 Ga0072940_1046172 3300005200 Bacteria 7571
85 Ga0074278_144901 3300005721 Bacteria 227040
86 Ga0466735_093272 3300042624 Bacteria 2769
87 Ga0466703_062220 3300042636 Bacteria 10088
88 Ga0466704_186215 3300042643 Bacteria 3918
89 Ga0466704_213444 3300042643 Bacteria 3210
90 Ga0562377_0016 3300056842 Bacteria 1202354
91 Ga0562375_5097 3300056856 Bacteria 8642
92 Ga0466690_182522 3300042590 Bacteria 3751
93 Ga0466696_008519 3300042596 Bacteria 8278
94 Ga0466696_084107 3300042596 Bacteria 5392
95 Ga0466707_327947 3300042601 Bacteria 9323
96 Ga0466713_105177 3300042602 Bacteria 5640
97 Ga0466716_344929 3300042605 Bacteria 10320
98 Ga0466722_230263 3300042609 Unclassified 2708
99 Ga0123357_10097567 3300009784 Bacteria 3801
100 Ga0123356_10002759 3300010049 Bacteria 18653
101 Ga0123356_10051383 3300010049 Unclassified 3834
102 Ga0123356_10107296 3300010049 Unclassified 2690
103 FGTW_contig31340 2065487013 Bacteria 4736
104 2227280797 2225789004 Bacteria 6819
105 HBC_ctgsDRAFT_1017937 3300000333 Bacteria 1723
106 SCG598L16_135364 3300000490 Unclassified 13689
107 Ga0068302_10380754 3300005071 Bacteria 1858
108 Ga0074278_128951 3300005721 Bacteria 7496
109 Ga0466705_430841 3300042612 Unclassified 1716
110 Ga0466715_015017 3300042616 Bacteria 24502
111 Ga0466723_038135 3300042618 Bacteria 4674
112 Ga0466726_186442 3300042619 Bacteria 1466
113 Ga0466726_361019 3300042619 Bacteria 1415
114 Ga0466726_471107 3300042619 Bacteria 4099
115 Ga0466728_028263 3300042620 Bacteria 3065
116 Ga0466735_160225 3300042624 Bacteria 1271
117 Ga0466703_249617 3300042636 Bacteria 8409
118 Ga0466703_355287 3300042636 Bacteria 1971
119 Ga0466704_251771 3300042643 Bacteria 3369
120 Ga0466705_053223 3300042612 Bacteria 5156
121 Ga0466705_183202 3300042612 Bacteria 4097
122 Ga0466705_251040 3300042612 Bacteria 3387
123 Ga0530661_000385 3300056564 Bacteria 33212
124 Ga0562379_3060 3300056790 Bacteria 12028
125 Ga0562375_0181 3300056856 Unclassified 184197
126 Ga0562375_0487 3300056856 Bacteria 82467
127 Ga0562375_5026 3300056856 Unclassified 8838
128 Ga0562374_2031 3300057007 Unclassified 20238
129 Ga0466694_174017 3300042594 Bacteria 8461
130 Ga0466696_099366 3300042596 Bacteria 3711
131 Ga0466707_017639 3300042601 Bacteria 2188
132 Ga0466716_071392 3300042605 Bacteria 9911
133 Ga0123355_10054998 3300009826 Bacteria 6445
134 Ga0123353_10161325 3300010167 Bacteria 3569
135 Ga0123354_10239750 3300010882 Bacteria 1869
136 DPOL_contig14784 2035918003 Bacteria 105378
137 SCG598P17_12932 3300000461 Bacteria 58384
138 JGI24695J34938_10004831 3300002450 Bacteria 8662
139 Ga0063521_1000013 3300003973 Bacteria 168262
140 Ga0063521_1000287 3300003973 Bacteria 30974
141 Ga0466711_095557 3300042615 Bacteria 9221
142 Ga0466711_319507 3300042615 Bacteria 1978
143 Ga0466703_385761 3300042636 Bacteria 1500
144 Ga0466704_197283 3300042643 Bacteria 6578
145 Ga0466704_230708 3300042643 Bacteria 6626
146 Ga0466704_451495 3300042643 Bacteria 4914
147 Ga0530661_001189 3300056564 Bacteria 14237
148 Ga0562379_1244 3300056790 Bacteria 31244
149 Ga0316159_10195 3300030930 Bacteria 10046
150 Ga0466691_147104 3300042593 Bacteria 23906
151 Ga0466695_265257 3300042595 Bacteria 1361
152 Ga0466707_141148 3300042601 Bacteria 1470
153 Ga0466717_054764 3300042604 Bacteria 1773
154 Ga0466719_070927 3300042606 Bacteria 2724
155 Ga0123353_10011316 3300010167 Bacteria 12557
156 gam1t_NODE_183394_length=15538_GC=34_0_Contigs=2 2189573031 Unclassified 15548
157 Ga0063521_1000460 3300003973 Bacteria 20298
158 Ga0104040_1150518 3300007149 Bacteria 1205
159 Ga0466715_296772 3300042616 Bacteria 10454
160 Ga0466718_010040 3300042617 Unclassified 4116
161 Ga0466735_225548 3300042624 Bacteria 3522
162 Ga0562378_0278 3300056814 Bacteria 112045
163 Ga0562375_0572 3300056856 Bacteria 72610
164 Ga0562376_6475 3300056857 Bacteria 4469
165 Ga0466707_229655 3300042601 Bacteria 71770
166 Ga0466713_019666 3300042602 Bacteria 67660
167 Ga0466717_017322 3300042604 Bacteria 3015
168 Ga0466722_162974 3300042609 Bacteria 4432
169 Ga0123355_10001035 3300009826 Bacteria 38529
170 Ga0123355_10093903 3300009826 Unclassified 4747
171 Ga0123356_10000725 3300010049 Bacteria 36392
172 Ga0123356_10033425 3300010049 Bacteria 4808
173 Ga0123356_10624832 3300010049 Bacteria 1243
174 Ga0123353_10464225 3300010167 Bacteria 1859
175 Ga0123354_10070044 3300010882 Bacteria 5077
176 IMNBL1DRAFT_c0005171 3300000062 Bacteria 7562
177 IMNBL1DRAFT_c0012582 3300000062 Unclassified 3859
178 Ga0074306_1118112 3300005309 Bacteria 2012
179 Ga0466711_491269 3300042615 Bacteria 2381
180 Ga0466715_016906 3300042616 Bacteria 8695
181 Ga0466718_074773 3300042617 Bacteria 6459
182 Ga0466718_130213 3300042617 Bacteria 1820
183 Ga0466723_105746 3300042618 Bacteria 7532
184 Ga0466726_461052 3300042619 Bacteria 1594
185 Ga0466728_342105 3300042620 Bacteria 3326
186 Ga0466729_135693 3300042621 Bacteria 8118
187 Ga0466735_002788 3300042624 Bacteria 2089
188 Ga0466704_114106 3300042643 Bacteria 24784
189 Ga0466704_196382 3300042643 Bacteria 52983
190 Ga0466727_256817 3300042655 Bacteria 1395

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04166 PdxA Pyridoxal phosphate biosynthetic protein PdxA 70 365 0.92

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF04166 GO:0051287 NAD binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.