Protein Family IF08008

Metagenome Metatranscriptome Isolate
140 Members
36 Samples
138 Scaffolds
256.87 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_027813|Ga0466723_027813_18_902
Length
294 aa
Sequence
MREKNGENMGNIDKNTDKRYNRPKNSFPGIGIRSSLMKQGSFRAVCVVLLACMALVSAYGDERTINSEAVIIEPFDGDTAHEWTVEGRTGSYEFDWSKDASKFATVAEGDEYPRLTYVSAWPQALFGNNRQGIDYKSLGIWGRFDRRGYNWIDIYPVEVGTDTPFEIPLPGRVHYLDMWVWGSNLQFYIEAFVRDYQGVVHTLRLGDISYTGWRNLRVSIPNTIRQSKRILPHYAGLQFVKFRIWTQPSERVDDFYIYFDQFKIVTDTFESFFDGDELADPEHVQELWAVSGNN

πŸ“Š Sample Types

Isolate 1.4%
Metagenome 97.1%
MAG 0.0%
Metatranscriptome 1.4%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Kalotermitidae 42.4%
Termitidae 30.3%
Unclassified 9.1%
Termopsidae 9.1%
Rhinotermitidae 6.1%
Blaberidae 3.0%

🌳 Taxonomy

Archaea 0
Bacteria 138
Eukaryota 0
Viruses 0
Unclassified 2

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300021220 Termite gut microbial communities from nest from French Guiana - FG16_9_6 mRNA SA Metatranscriptome
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
12 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
13 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
14 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
15 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
16 2772190975 Treponema sp. RmG30 Isolate Blaberidae
17 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
18 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
19 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
20 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
21 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
22 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
23 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
24 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
25 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
26 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
29 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
30 3300021239 Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA Metatranscriptome
31 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
32 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
33 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
34 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
35 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
36 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466691_068316 3300042593 Bacteria 35532
2 Ga0466694_113535 3300042594 Bacteria 5330
3 Ga0466699_157697 3300042597 Bacteria 2916
4 Ga0068305_10800663 3300005083 Bacteria 8575
5 Ga0466711_236469 3300042615 Bacteria 97130
6 Ga0466723_089597 3300042618 Bacteria 3572
7 Ga0466723_233143 3300042618 Bacteria 28706
8 Ga0466735_087009 3300042624 Bacteria 4182
9 Ga0466704_250975 3300042643 Bacteria 3750
10 Ga0466704_335796 3300042643 Bacteria 67702
11 Ga0466708_455563 3300042652 Bacteria 2808
12 Ga0466719_048637 3300042606 Bacteria 10963
13 Ga0466719_347153 3300042606 Bacteria 4026
14 Ga0466719_376993 3300042606 Bacteria 5034
15 Ga0466719_526121 3300042606 Bacteria 1133
16 Ga0466720_004688 3300042607 Bacteria 13252
17 Ga0466720_015865 3300042607 Bacteria 15796
18 Ga0466720_067267 3300042607 Bacteria 8369
19 Ga0466720_091089 3300042607 Bacteria 3133
20 Ga0466720_106657 3300042607 Bacteria 19707
21 Ga0466722_007037 3300042609 Bacteria 4648
22 Ga0466732_051898 3300042656 Bacteria 74540
23 Ga0223680_102059 3300021220 Bacteria 1614
24 Ga0223677_1009021 3300021239 Bacteria 1433
25 Ga0264413_104183 3300024493 Bacteria 6600
26 Ga0264413_119379 3300024493 Bacteria 2984
27 Ga0466690_346053 3300042590 Bacteria 2455
28 Ga0466691_089756 3300042593 Bacteria 7175
29 Ga0466694_324243 3300042594 Bacteria 1754
30 Ga0466696_218027 3300042596 Bacteria 9062
31 Ga0466696_244990 3300042596 Bacteria 5062
32 AustNasuHG_c1029702 3300000089 Bacteria 1593
33 Ga0123353_10080020 3300010167 Bacteria 5255
34 Ga0466715_206361 3300042616 Bacteria 12461
35 Ga0466723_300287 3300042618 Bacteria 3238
36 Ga0466726_004928 3300042619 Bacteria 2166
37 Ga0466728_080024 3300042620 Bacteria 18381
38 Ga0466728_160568 3300042620 Bacteria 17497
39 Ga0466703_015135 3300042636 Bacteria 49157
40 Ga0466703_023767 3300042636 Bacteria 2726
41 Ga0466704_128155 3300042643 Bacteria 28523
42 Ga0466704_263856 3300042643 Bacteria 3831
43 Ga0466709_130608 3300042648 Bacteria 7106
44 Ga0466708_280160 3300042652 Bacteria 9278
45 Ga0466720_062128 3300042607 Bacteria 4068
46 Ga0466722_111888 3300042609 Bacteria 6156
47 Ga0466705_271225 3300042612 Bacteria 3560
48 Ga0466732_390376 3300042656 Bacteria 5205
49 Ga0264413_122530 3300024493 Bacteria 2864
50 Ga0466694_274033 3300042594 Bacteria 26693
51 Ga0466712_274787 3300042614 Bacteria 6963
52 Ga0466711_113548 3300042615 Bacteria 36298
53 Ga0466723_148519 3300042618 Bacteria 15080
54 Ga0466723_318907 3300042618 Bacteria 3991
55 Ga0466728_475229 3300042620 Bacteria 3890
56 Ga0466704_305606 3300042643 Bacteria 29402
57 Ga0466709_399705 3300042648 Bacteria 2373
58 Ga0466708_199104 3300042652 Bacteria 3204
59 Ga0466708_456071 3300042652 Bacteria 2806
60 Ga0466700_212205 3300042600 Bacteria 1275
61 Ga0466716_201114 3300042605 Bacteria 39030
62 Ga0466720_082193 3300042607 Bacteria 6153
63 Ga0466720_226798 3300042607 Bacteria 5016
64 Ga0466722_125859 3300042609 Bacteria 5198
65 Ga0466696_180220 3300042596 Bacteria 6308
66 Ga0466699_122766 3300042597 Bacteria 7781
67 AustNasuHG_c1002884 3300000089 Bacteria 6208
68 Ga0466718_023500 3300042617 Bacteria 3189
69 Ga0466723_024084 3300042618 Bacteria 42350
70 Ga0466729_168704 3300042621 Bacteria 3442
71 Ga0466716_370937 3300042605 Bacteria 2890
72 Ga0466716_536308 3300042605 Bacteria 1824
73 Ga0466720_031852 3300042607 Bacteria 7594
74 Ga0466720_062325 3300042607 Bacteria 28961
75 Ga0466722_183378 3300042609 Bacteria 7506
76 Ga0466705_127577 3300042612 Bacteria 32685
77 Ga0466705_338674 3300042612 Bacteria 3456
78 Ga0466690_109219 3300042590 Bacteria 1409
79 Ga0466690_205288 3300042590 Bacteria 1222
80 Ga0466691_034660 3300042593 Bacteria 57357
81 Ga0466696_423691 3300042596 Bacteria 31979
82 Ga0466711_183178 3300042615 Bacteria 53190
83 Ga0466715_536951 3300042616 Bacteria 7249
84 Ga0466718_086776 3300042617 Bacteria 73105
85 Ga0466728_027336 3300042620 Bacteria 21574
86 Ga0466728_127916 3300042620 Bacteria 3626
87 Ga0466728_162119 3300042620 Bacteria 8718
88 Ga0466703_049531 3300042636 Bacteria 42822
89 Ga0466704_163988 3300042643 Bacteria 31139
90 Ga0466709_280168 3300042648 Bacteria 28407
91 Ga0466727_066843 3300042655 Bacteria 1171
92 Ga0466727_074225 3300042655 Bacteria 3053
93 Ga0466719_203977 3300042606 Bacteria 7740
94 Ga0466720_091144 3300042607 Bacteria 2875
95 Ga0466705_105677 3300042612 Bacteria 19143
96 Ga0466705_341846 3300042612 Bacteria 2786
97 Ga0466732_414063 3300042656 Bacteria 5558
98 Ga0466696_396821 3300042596 Bacteria 23354
99 Ga0466699_060995 3300042597 Bacteria 46589
100 Ga0466699_294709 3300042597 Bacteria 1226
101 AustNasuHG_c1006172 3300000089 Bacteria 4282
102 Ga0072940_1051775 3300005200 Bacteria 2478
103 Ga0466715_415539 3300042616 Bacteria 5510
104 Ga0466715_432826 3300042616 Bacteria 7853
105 Ga0466723_027813 3300042618 Bacteria 4459
106 Ga0466728_227423 3300042620 Bacteria 6633
107 Ga0466703_220845 3300042636 Bacteria 51302
108 Ga0466708_028808 3300042652 Bacteria 2129
109 Ga0466708_068830 3300042652 Bacteria 16777
110 Ga0466727_049047 3300042655 Bacteria 11026
111 Ga0466720_021934 3300042607 Bacteria 78212
112 Ga0466705_169714 3300042612 Bacteria 6814
113 Ga0264413_100619 3300024493 Bacteria 17189
114 Ga0466691_168729 3300042593 Bacteria 1483
115 Ga0466696_278873 3300042596 Unclassified 1694
116 Ga0072940_1051788 3300005200 Bacteria 3705
117 Ga0466718_142814 3300042617 Bacteria 16284
118 Ga0466723_195456 3300042618 Bacteria 36467
119 Ga0466704_249706 3300042643 Bacteria 5732
120 Ga0466704_279746 3300042643 Bacteria 16266
121 Ga0466709_115105 3300042648 Bacteria 20186
122 Ga0466708_131985 3300042652 Bacteria 5705
123 Ga0466713_031672 3300042602 Bacteria 3842
124 Ga0466720_088525 3300042607 Bacteria 28475
125 Ga0466705_054661 3300042612 Bacteria 27078
126 Ga0466705_167883 3300042612 Bacteria 3257
127 Ga0264413_100618 3300024493 Bacteria 16207
128 Ga0466690_068739 3300042590 Unclassified 3737
129 Ga0466696_041001 3300042596 Bacteria 21262
130 Ga0466696_206474 3300042596 Bacteria 3988
131 Ga0466696_331190 3300042596 Bacteria 65152
132 Ga0466699_181103 3300042597 Bacteria 2424
133 Ga0466715_063066 3300042616 Bacteria 49420
134 Ga0466723_291250 3300042618 Bacteria 3078
135 Ga0466726_232852 3300042619 Bacteria 1320
136 Ga0466704_592969 3300042643 Bacteria 6625
137 Ga0466708_202662 3300042652 Bacteria 29963
138 Ga0466700_005809 3300042600 Bacteria 2613

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042652 Ga0466708_068830 Ga0466708_068830_10826_11509 227
2 3300042597 Ga0466699_294709 Ga0466699_294709_506_1192 228
3 3300042652 Ga0466708_455563 Ga0466708_455563_2108_2794 228
4 3300042652 Ga0466708_456071 Ga0466708_456071_2106_2792 228
5 3300042609 Ga0466722_125859 Ga0466722_125859_3480_4175 231
6 3300042618 Ga0466723_300287 Ga0466723_300287_1424_2122 232
7 3300042612 Ga0466705_105677 Ga0466705_105677_15400_16104 234
8 3300042609 Ga0466722_183378 Ga0466722_183378_439_1149 236
9 3300042618 Ga0466723_233143 Ga0466723_233143_1220_1987 238
10 3300042606 Ga0466719_203977 Ga0466719_203977_1245_1973 242
11 3300042612 Ga0466705_127577 Ga0466705_127577_1620_2348 242
12 3300042620 Ga0466728_227423 Ga0466728_227423_4999_5727 242
13 3300042643 Ga0466704_592969 Ga0466704_592969_1247_1975 242
14 3300042648 Ga0466709_280168 Ga0466709_280168_1500_2228 242
15 3300042652 Ga0466708_131985 Ga0466708_131985_3935_4663 242
16 3300042652 Ga0466708_280160 Ga0466708_280160_3870_4598 242
17 3300042615 Ga0466711_113548 Ga0466711_113548_10661_11392 243
18 3300042596 Ga0466696_331190 Ga0466696_331190_56531_57304 244
19 3300042590 Ga0466690_205288 Ga0466690_205288_130_867 245
20 3300042593 Ga0466691_168729 Ga0466691_168729_582_1319 245
21 3300042596 Ga0466696_396821 Ga0466696_396821_18227_18964 245
22 3300042606 Ga0466719_526121 Ga0466719_526121_119_856 245
23 3300042612 Ga0466705_338674 Ga0466705_338674_1940_2677 245
24 3300042616 Ga0466715_415539 Ga0466715_415539_1818_2555 245
25 3300042643 Ga0466704_249706 Ga0466704_249706_2756_3493 245
26 3300042648 Ga0466709_399705 Ga0466709_399705_1002_1739 245
27 3300042600 Ga0466700_212205 Ga0466700_212205_156_896 246
28 3300042602 Ga0466713_031672 Ga0466713_031672_1311_2069 246
29 iso_pr_bacteria 2772190975 2773723729 246
30 3300042590 Ga0466690_109219 Ga0466690_109219_116_895 247
31 3300042593 Ga0466691_034660 Ga0466691_034660_24292_25035 247
32 3300042605 Ga0466716_536308 Ga0466716_536308_794_1537 247
33 3300042620 Ga0466728_162119 Ga0466728_162119_6334_7077 247
34 3300042618 Ga0466723_148519 Ga0466723_148519_12453_13241 248
35 3300042621 Ga0466729_168704 Ga0466729_168704_2436_3182 248
36 3300042596 Ga0466696_206474 Ga0466696_206474_2406_3155 249
37 3300042606 Ga0466719_376993 Ga0466719_376993_3382_4158 249
38 3300042612 Ga0466705_167883 Ga0466705_167883_168_917 249
39 3300042643 Ga0466704_279746 Ga0466704_279746_8583_9356 249
40 3300042609 Ga0466722_111888 Ga0466722_111888_3686_4438 250
41 3300042615 Ga0466711_236469 Ga0466711_236469_48418_49170 250
42 3300042619 Ga0466726_232852 Ga0466726_232852_267_1022 251
43 3300042655 Ga0466727_074225 Ga0466727_074225_155_910 251
44 3300042619 Ga0466726_004928 Ga0466726_004928_650_1408 252
45 3300042618 Ga0466723_318907 Ga0466723_318907_788_1549 253
46 3300042620 Ga0466728_475229 Ga0466728_475229_1373_2134 253
47 3300042596 Ga0466696_041001 Ga0466696_041001_8304_9068 254
48 3300042620 Ga0466728_027336 Ga0466728_027336_16491_17255 254
49 3300042605 Ga0466716_370937 Ga0466716_370937_1553_2320 255
50 3300042618 Ga0466723_024084 Ga0466723_024084_32317_33084 255
51 3300042620 Ga0466728_080024 Ga0466728_080024_3619_4386 255
52 3300042620 Ga0466728_127916 Ga0466728_127916_1367_2134 255
53 3300042648 Ga0466709_115105 Ga0466709_115105_14669_15436 255
54 3300042652 Ga0466708_199104 Ga0466708_199104_75_842 255
55 3300042652 Ga0466708_202662 Ga0466708_202662_26792_27559 255
56 3300042590 Ga0466690_346053 Ga0466690_346053_1284_2054 256
57 3300042593 Ga0466691_068316 Ga0466691_068316_24555_25325 256
58 3300042593 Ga0466691_089756 Ga0466691_089756_6395_7165 256
59 3300042596 Ga0466696_180220 Ga0466696_180220_958_1728 256
60 3300042596 Ga0466696_423691 Ga0466696_423691_29156_29926 256
61 3300042605 Ga0466716_201114 Ga0466716_201114_12580_13350 256
62 3300042606 Ga0466719_048637 Ga0466719_048637_9084_9854 256
63 3300042612 Ga0466705_169714 Ga0466705_169714_3841_4611 256
64 3300042612 Ga0466705_271225 Ga0466705_271225_785_1555 256
65 3300042612 Ga0466705_341846 Ga0466705_341846_1100_1870 256
66 3300042615 Ga0466711_183178 Ga0466711_183178_25220_25990 256
67 3300042616 Ga0466715_206361 Ga0466715_206361_3151_3921 256
68 3300042618 Ga0466723_195456 Ga0466723_195456_7869_8639 256
69 3300042618 Ga0466723_291250 Ga0466723_291250_1403_2173 256
70 3300042636 Ga0466703_049531 Ga0466703_049531_35131_35901 256
71 3300042636 Ga0466703_220845 Ga0466703_220845_37744_38514 256
72 3300042643 Ga0466704_163988 Ga0466704_163988_28169_28939 256
73 3300042643 Ga0466704_250975 Ga0466704_250975_1259_2029 256
74 3300042643 Ga0466704_263856 Ga0466704_263856_1228_1998 256
75 3300042643 Ga0466704_335796 Ga0466704_335796_34494_35264 256
76 3300042648 Ga0466709_130608 Ga0466709_130608_1637_2407 256
77 3300042652 Ga0466708_028808 Ga0466708_028808_54_824 256
78 3300042590 Ga0466690_068739 Ga0466690_068739_2281_3057 258
79 3300042596 Ga0466696_218027 Ga0466696_218027_2833_3609 258
80 3300042596 Ga0466696_244990 Ga0466696_244990_798_1574 258
81 3300042596 Ga0466696_278873 Ga0466696_278873_74_850 258
82 3300042616 Ga0466715_432826 Ga0466715_432826_1754_2530 258
83 3300042616 Ga0466715_536951 Ga0466715_536951_1236_2012 258
84 3300042618 Ga0466723_089597 Ga0466723_089597_1813_2589 258
85 3300042620 Ga0466728_160568 Ga0466728_160568_11764_12540 258
86 3300042624 Ga0466735_087009 Ga0466735_087009_839_1615 258
87 3300042636 Ga0466703_023767 Ga0466703_023767_936_1712 258
88 3300042643 Ga0466704_128155 Ga0466704_128155_1700_2476 258
89 3300042655 Ga0466727_049047 Ga0466727_049047_7779_8555 258
90 3300042616 Ga0466715_063066 Ga0466715_063066_18374_19153 259
91 3300042600 Ga0466700_005809 Ga0466700_005809_1733_2518 261
92 3300024493 Ga0264413_100619 Ga0264413_1006193 262
93 3300024493 Ga0264413_119379 Ga0264413_1193792 262
94 3300042607 Ga0466720_062128 Ga0466720_062128_1848_2636 262
95 3300042607 Ga0466720_091144 Ga0466720_091144_1354_2142 262
96 3300042609 Ga0466722_007037 Ga0466722_007037_1970_2758 262
97 3300042617 Ga0466718_086776 Ga0466718_086776_35351_36139 262
98 3300024493 Ga0264413_100618 Ga0264413_1006183 263
99 3300042597 Ga0466699_060995 Ga0466699_060995_42722_43513 263
100 3300042597 Ga0466699_122766 Ga0466699_122766_5686_6477 263
101 3300042597 Ga0466699_157697 Ga0466699_157697_412_1203 263
102 3300042597 Ga0466699_181103 Ga0466699_181103_281_1072 263
103 3300042607 Ga0466720_015865 Ga0466720_015865_6478_7269 263
104 3300042614 Ga0466712_274787 Ga0466712_274787_4600_5391 263
105 iso_pr_bacteria 2781125631 2781267870 263
106 3300042594 Ga0466694_324243 Ga0466694_324243_26_820 264
107 3300042607 Ga0466720_226798 Ga0466720_226798_2434_3231 265
108 3300042656 Ga0466732_414063 Ga0466732_414063_3605_4402 265
109 3300042594 Ga0466694_113535 Ga0466694_113535_2488_3288 266
110 3300042594 Ga0466694_274033 Ga0466694_274033_16101_16901 266
111 3300042612 Ga0466705_054661 Ga0466705_054661_970_1770 266
112 3300042643 Ga0466704_305606 Ga0466704_305606_1556_2356 266
113 3300042606 Ga0466719_347153 Ga0466719_347153_2402_3205 267
114 3300010167 Ga0123353_10080020 Ga0123353_100800202 268
115 3300024493 Ga0264413_104183 Ga0264413_1041832 268
116 3300042607 Ga0466720_088525 Ga0466720_088525_13555_14361 268
117 3300042607 Ga0466720_106657 Ga0466720_106657_16303_17109 268
118 3300021239 Ga0223677_1009021 Ga0223677_10090212 269
119 3300042607 Ga0466720_062325 Ga0466720_062325_20037_20846 269
120 3300042607 Ga0466720_067267 Ga0466720_067267_6268_7077 269
121 3300042607 Ga0466720_091089 Ga0466720_091089_600_1409 269
122 3300042617 Ga0466718_023500 Ga0466718_023500_1943_2752 269
123 3300042656 Ga0466732_051898 Ga0466732_051898_13672_14481 269
124 3300000089 AustNasuHG_c1002884 AustNasuHG_10028843 270
125 3300021220 Ga0223680_102059 Ga0223680_1020592 270
126 3300042607 Ga0466720_004688 Ga0466720_004688_1836_2648 270
127 3300042607 Ga0466720_021934 Ga0466720_021934_35143_35955 270
128 3300042607 Ga0466720_031852 Ga0466720_031852_5162_5974 270
129 3300042607 Ga0466720_082193 Ga0466720_082193_4067_4879 270
130 3300042617 Ga0466718_142814 Ga0466718_142814_4656_5468 270
131 3300042656 Ga0466732_390376 Ga0466732_390376_3596_4408 270
132 3300000089 AustNasuHG_c1006172 AustNasuHG_10061723 271
133 3300000089 AustNasuHG_c1029702 AustNasuHG_10297023 271
134 3300005200 Ga0072940_1051775 Ga0072940_10517753 271
135 3300005200 Ga0072940_1051788 Ga0072940_10517884 271
136 3300024493 Ga0264413_122530 Ga0264413_1225302 279
137 3300042636 Ga0466703_015135 Ga0466703_015135_8872_9726 284
138 3300042655 Ga0466727_066843 Ga0466727_066843_138_1010 290
139 3300042618 Ga0466723_027813 Ga0466723_027813_18_902 294
140 3300005083 Ga0068305_10800663 Ga0068305_108006636 342

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04620 FlaA Flagellar filament outer layer protein Flaa 134 269 0.91

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.7 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.