Protein Family IF08006

Metagenome Isolate
125 Members
38 Samples
123 Scaffolds
347.72 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_026659|Ga0466723_026659_12495_13700
Length
401 aa
Sequence
LRFRDSHEHEKVSEALPLFHKTLDCIRGFLLPCNNLREVFMKPQNRTQGAMPRRLLACSLLLWLACIQGFGLGNKEEPTKGTGDPAFQRSIAVFIPGVMSGSPIYEMLAQGVKQAGAEKSTEERTVTVTVIEGGFNQAEWEGRITALAASGNYDLIVSSNPSLPAIAASVASKFPKQRFLLLDGKIEGNPQIYTLRYNQREQAYMAGHIAALVAGEGAPEGGPAVRIGLVAGQEYPAMNEVILPAYREGARQVDPQATVDFRVVGNWFDAGKGAELAADMIRGGAKVILSIAGSANEGVVQAAAEAGAKAVWFDINGYAVRPGTVVGSAVVYQDKAAYEQTLRFLEGTLPFGKAELLGVAEGYVDFIETDPHYRASVSAPIREKQGVLIGQIRSGALRLEE

📊 Sample Types

Isolate 1.6%
Metagenome 98.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 37.8%
Termitidae 32.4%
Unclassified 10.8%
Rhinotermitidae 8.1%
Termopsidae 8.1%
Blaberidae 2.7%

🌳 Taxonomy

Archaea 0
Bacteria 124
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
4 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
5 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
6 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
7 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
8 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
9 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
10 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
11 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
12 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
13 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
14 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
15 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
16 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
21 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
22 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
23 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
24 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
25 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
26 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
27 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
30 2772190975 Treponema sp. RmG30 Isolate Blaberidae
31 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
32 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
33 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
34 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
35 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
36 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
37 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
38 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_074409 3300042659 Bacteria 4621
2 Ga0466715_077254 3300042616 Bacteria 24143
3 Ga0466715_242547 3300042616 Bacteria 5490
4 Ga0466726_057171 3300042619 Bacteria 4837
5 Ga0466726_293711 3300042619 Bacteria 14655
6 Ga0466690_031567 3300042590 Bacteria 39446
7 Ga0466700_254940 3300042600 Bacteria 2307
8 Ga0466716_208534 3300042605 Bacteria 2274
9 Ga0466719_338106 3300042606 Bacteria 21984
10 Ga0466735_204143 3300042624 Bacteria 7310
11 Ga0466703_078874 3300042636 Bacteria 4029
12 Ga0466704_032513 3300042643 Bacteria 4718
13 Ga0466708_111835 3300042652 Bacteria 4376
14 Ga0466727_118925 3300042655 Bacteria 7351
15 Ga0466727_305252 3300042655 Bacteria 1579
16 Ga0466733_013658 3300042659 Bacteria 32528
17 Ga0123353_10768832 3300010167 Bacteria 1337
18 Ga0466711_050170 3300042615 Bacteria 2866
19 Ga0466711_512790 3300042615 Bacteria 5399
20 Ga0466726_182834 3300042619 Bacteria 2808
21 Ga0466726_404353 3300042619 Bacteria 1110
22 Ga0466691_058612 3300042593 Bacteria 167737
23 Ga0466691_167714 3300042593 Bacteria 14084
24 Ga0466700_146900 3300042600 Bacteria 1345
25 Ga0466722_185587 3300042609 Bacteria 2486
26 Ga0466708_219670 3300042652 Bacteria 11638
27 Ga0466705_223469 3300042612 Bacteria 3319
28 Ga0466733_037501 3300042659 Bacteria 1983
29 Ga0123353_10011696 3300010167 Bacteria 12385
30 Ga0123353_10105352 3300010167 Bacteria 4545
31 Ga0466712_020147 3300042614 Bacteria 1633
32 Ga0466712_181350 3300042614 Bacteria 4777
33 Ga0466711_250165 3300042615 Bacteria 77191
34 Ga0466711_270444 3300042615 Bacteria 11279
35 Ga0466715_097861 3300042616 Bacteria 28870
36 Ga0466715_420933 3300042616 Bacteria 11310
37 Ga0466715_608878 3300042616 Bacteria 2141
38 Ga0466723_026659 3300042618 Bacteria 21026
39 Ga0466726_438975 3300042619 Bacteria 2982
40 Ga0466696_151288 3300042596 Bacteria 6764
41 Ga0466696_258149 3300042596 Bacteria 13063
42 Ga0466707_419580 3300042601 Bacteria 2434
43 Ga0466716_108459 3300042605 Bacteria 7583
44 Ga0466722_094639 3300042609 Bacteria 1250
45 Ga0466709_310184 3300042648 Bacteria 21422
46 Ga0466708_184808 3300042652 Bacteria 4791
47 Ga0466732_105123 3300042656 Bacteria 2205
48 Ga0466733_162788 3300042659 Bacteria 2213
49 Ga0466733_167931 3300042659 Bacteria 9812
50 Ga0466723_140183 3300042618 Bacteria 4681
51 Ga0466726_155204 3300042619 Bacteria 1953
52 Ga0466728_464196 3300042620 Bacteria 2967
53 Ga0466692_179287 3300042591 Bacteria 5909
54 Ga0466691_060495 3300042593 Bacteria 5105
55 Ga0466716_166132 3300042605 Bacteria 7578
56 Ga0466716_444536 3300042605 Bacteria 7069
57 Ga0466719_144176 3300042606 Bacteria 32253
58 Ga0466719_441814 3300042606 Bacteria 1889
59 Ga0466704_068206 3300042643 Bacteria 27005
60 Ga0466709_416967 3300042648 Bacteria 6450
61 Ga0466708_014218 3300042652 Bacteria 9345
62 JGI24698J34947_10012853 3300002449 Bacteria 4577
63 Ga0123353_10255026 3300010167 Bacteria 2713
64 Ga0466712_039278 3300042614 Bacteria 5621
65 Ga0466715_057946 3300042616 Bacteria 8578
66 Ga0466718_042151 3300042617 Bacteria 2446
67 Ga0466723_064290 3300042618 Bacteria 18329
68 Ga0466728_448871 3300042620 Bacteria 1343
69 Ga0466690_126417 3300042590 Bacteria 3393
70 Ga0466691_199179 3300042593 Bacteria 10697
71 Ga0466694_217378 3300042594 Bacteria 2578
72 Ga0466694_234888 3300042594 Bacteria 1224
73 Ga0466694_266458 3300042594 Bacteria 10083
74 Ga0466713_105632 3300042602 Bacteria 6949
75 Ga0466722_030437 3300042609 Bacteria 5972
76 Ga0466722_093627 3300042609 Bacteria 4873
77 Ga0466722_166903 3300042609 Bacteria 7862
78 Ga0466703_030252 3300042636 Bacteria 46951
79 Ga0466703_270813 3300042636 Bacteria 5835
80 Ga0466709_268129 3300042648 Bacteria 1286
81 Ga0466709_380709 3300042648 Bacteria 2689
82 Ga0466705_483465 3300042612 Bacteria 7838
83 Ga0466723_041127 3300042618 Bacteria 26781
84 Ga0456237_0001776 3300041968 Bacteria 3475
85 Ga0466691_056401 3300042593 Bacteria 10069
86 Ga0466691_104510 3300042593 Bacteria 5371
87 Ga0466716_088790 3300042605 Bacteria 15243
88 Ga0466719_205238 3300042606 Bacteria 4966
89 Ga0466719_369676 3300042606 Bacteria 5138
90 Ga0466722_205018 3300042609 Bacteria 7264
91 Ga0466731_153785 3300042622 Bacteria 1517
92 Ga0466703_300653 3300042636 Bacteria 10877
93 Ga0466704_319580 3300042643 Bacteria 16194
94 Ga0068305_10015024 3300005083 Bacteria 2700
95 Ga0466705_074997 3300042612 Bacteria 2053
96 Ga0466733_087393 3300042659 Bacteria 4430
97 Ga0466715_105274 3300042616 Bacteria 35913
98 Ga0466728_040673 3300042620 Bacteria 22869
99 Ga0466690_213299 3300042590 Bacteria 1542
100 Ga0466692_040036 3300042591 Bacteria 2052
101 Ga0466701_089483 3300042598 Bacteria 1317
102 Ga0466719_045356 3300042606 Bacteria 2189
103 Ga0466719_209401 3300042606 Bacteria 9384
104 Ga0466698_114643 3300042610 Bacteria 1423
105 Ga0466735_155112 3300042624 Bacteria 2744
106 Ga0466704_095845 3300042643 Bacteria 89284
107 Ga0466709_248107 3300042648 Bacteria 14856
108 Ga0466709_354862 3300042648 Bacteria 8431
109 Ga0123357_10157882 3300009784 Bacteria 2729
110 Ga0466715_010031 3300042616 Bacteria 13524
111 Ga0466726_041847 3300042619 Bacteria 4010
112 Ga0466726_129985 3300042619 Bacteria 11594
113 Ga0466726_267845 3300042619 Unclassified 5316
114 Ga0466726_367837 3300042619 Bacteria 1277
115 Ga0466692_123665 3300042591 Bacteria 13247
116 Ga0466691_224847 3300042593 Bacteria 4302
117 Ga0466716_283272 3300042605 Bacteria 3743
118 Ga0466719_002263 3300042606 Bacteria 5670
119 Ga0466719_432905 3300042606 Bacteria 1905
120 Ga0466731_236417 3300042622 Bacteria 1174
121 Ga0466704_496283 3300042643 Bacteria 1968
122 JGI24698J34947_10003547 3300002449 Bacteria 8472
123 Ga0072941_1004616 3300005201 Bacteria 18977

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_032513 Ga0466704_032513_790_1665 291
2 3300042652 Ga0466708_219670 Ga0466708_219670_1696_2583 295
3 3300042620 Ga0466728_448871 Ga0466728_448871_411_1310 299
4 3300042593 Ga0466691_224847 Ga0466691_224847_3329_4231 300
5 3300042614 Ga0466712_020147 Ga0466712_020147_690_1592 300
6 3300042612 Ga0466705_223469 Ga0466705_223469_1696_2604 302
7 3300042619 Ga0466726_041847 Ga0466726_041847_773_1684 303
8 3300042652 Ga0466708_184808 Ga0466708_184808_3412_4329 305
9 3300042616 Ga0466715_077254 Ga0466715_077254_22233_23171 312
10 3300042591 Ga0466692_040036 Ga0466692_040036_932_1987 322
11 3300041968 Ga0456237_0001776 Ga0456237_0001776_832_1812 326
12 3300042618 Ga0466723_041127 Ga0466723_041127_4318_5370 326
13 3300042619 Ga0466726_155204 Ga0466726_155204_880_1860 326
14 3300042619 Ga0466726_267845 Ga0466726_267845_531_1514 327
15 3300042619 Ga0466726_182834 Ga0466726_182834_1020_2048 329
16 3300042643 Ga0466704_095845 Ga0466704_095845_77017_78057 329
17 3300042619 Ga0466726_057171 Ga0466726_057171_1258_2250 330
18 3300042648 Ga0466709_268129 Ga0466709_268129_106_1098 330
19 3300042636 Ga0466703_270813 Ga0466703_270813_3905_4900 331
20 3300042655 Ga0466727_118925 Ga0466727_118925_3843_4838 331
21 3300042590 Ga0466690_213299 Ga0466690_213299_250_1287 333
22 3300042619 Ga0466726_293711 Ga0466726_293711_10111_11118 335
23 3300042602 Ga0466713_105632 Ga0466713_105632_673_1746 336
24 3300042605 Ga0466716_444536 Ga0466716_444536_5734_6744 336
25 3300042617 Ga0466718_042151 Ga0466718_042151_877_1890 337
26 3300042619 Ga0466726_129985 Ga0466726_129985_1727_2740 337
27 3300042616 Ga0466715_010031 Ga0466715_010031_5366_6382 338
28 3300042616 Ga0466715_057946 Ga0466715_057946_3836_4855 339
29 3300042618 Ga0466723_140183 Ga0466723_140183_3602_4621 339
30 3300042648 Ga0466709_416967 Ga0466709_416967_2662_3681 339
31 3300042593 Ga0466691_058612 Ga0466691_058612_65956_66978 340
32 3300042609 Ga0466722_166903 Ga0466722_166903_5912_6934 340
33 3300042615 Ga0466711_270444 Ga0466711_270444_3716_4738 340
34 3300042619 Ga0466726_438975 Ga0466726_438975_998_2020 340
35 3300042655 Ga0466727_305252 Ga0466727_305252_346_1368 340
36 3300042606 Ga0466719_441814 Ga0466719_441814_847_1872 341
37 3300042609 Ga0466722_093627 Ga0466722_093627_775_1800 341
38 3300042619 Ga0466726_404353 Ga0466726_404353_62_1087 341
39 3300042615 Ga0466711_050170 Ga0466711_050170_1477_2505 342
40 3300042618 Ga0466723_064290 Ga0466723_064290_1569_2627 342
41 3300042636 Ga0466703_300653 Ga0466703_300653_8514_9542 342
42 3300042594 Ga0466694_217378 Ga0466694_217378_641_1672 343
43 3300042622 Ga0466731_236417 Ga0466731_236417_68_1099 343
44 3300010167 Ga0123353_10255026 Ga0123353_102550262 344
45 3300042598 Ga0466701_089483 Ga0466701_089483_154_1188 344
46 3300042609 Ga0466722_094639 Ga0466722_094639_125_1159 344
47 3300042609 Ga0466722_185587 Ga0466722_185587_560_1594 344
48 3300042636 Ga0466703_078874 Ga0466703_078874_1867_2904 345
49 3300042596 Ga0466696_151288 Ga0466696_151288_3130_4170 346
50 3300042606 Ga0466719_205238 Ga0466719_205238_569_1609 346
51 3300042606 Ga0466719_209401 Ga0466719_209401_3349_4389 346
52 3300042656 Ga0466732_105123 Ga0466732_105123_931_1971 346
53 3300042590 Ga0466690_126417 Ga0466690_126417_321_1364 347
54 3300042594 Ga0466694_266458 Ga0466694_266458_8856_9899 347
55 3300042600 Ga0466700_146900 Ga0466700_146900_273_1316 347
56 3300042605 Ga0466716_108459 Ga0466716_108459_3897_4940 347
57 3300042606 Ga0466719_338106 Ga0466719_338106_4524_5567 347
58 3300042616 Ga0466715_608878 Ga0466715_608878_506_1549 347
59 3300042643 Ga0466704_068206 Ga0466704_068206_11199_12242 347
60 3300002449 JGI24698J34947_10003547 JGI24698J34947_100035476 348
61 3300005083 Ga0068305_10015024 Ga0068305_100150242 348
62 3300042648 Ga0466709_310184 Ga0466709_310184_13875_14921 348
63 3300042648 Ga0466709_380709 Ga0466709_380709_142_1188 348
64 3300042659 Ga0466733_013658 Ga0466733_013658_15197_16243 348
65 iso_pr_bacteria 2781125694 2781435418 348
66 3300010167 Ga0123353_10105352 Ga0123353_101053523 349
67 3300042593 Ga0466691_104510 Ga0466691_104510_760_1809 349
68 3300042614 Ga0466712_039278 Ga0466712_039278_3070_4119 349
69 3300042652 Ga0466708_014218 Ga0466708_014218_2707_3756 349
70 3300010167 Ga0123353_10011696 Ga0123353_100116962 350
71 3300042600 Ga0466700_254940 Ga0466700_254940_397_1533 350
72 3300042601 Ga0466707_419580 Ga0466707_419580_811_1863 350
73 3300042606 Ga0466719_369676 Ga0466719_369676_2124_3176 350
74 3300042609 Ga0466722_030437 Ga0466722_030437_1523_2575 350
75 3300042610 Ga0466698_114643 Ga0466698_114643_39_1091 350
76 3300042612 Ga0466705_074997 Ga0466705_074997_456_1508 350
77 3300042619 Ga0466726_367837 Ga0466726_367837_116_1168 350
78 3300042659 Ga0466733_162788 Ga0466733_162788_278_1330 350
79 iso_pr_bacteria 2772190975 2773721429 350
80 3300042591 Ga0466692_179287 Ga0466692_179287_352_1407 351
81 3300042593 Ga0466691_056401 Ga0466691_056401_3856_4911 351
82 3300042620 Ga0466728_040673 Ga0466728_040673_800_1855 351
83 3300042659 Ga0466733_167931 Ga0466733_167931_2910_3965 351
84 3300042605 Ga0466716_283272 Ga0466716_283272_2661_3719 352
85 3300042606 Ga0466719_144176 Ga0466719_144176_4256_5314 352
86 3300042659 Ga0466733_087393 Ga0466733_087393_709_1767 352
87 3300042622 Ga0466731_153785 Ga0466731_153785_312_1373 353
88 3300042616 Ga0466715_105274 Ga0466715_105274_5512_6576 354
89 3300010167 Ga0123353_10768832 Ga0123353_107688321 355
90 3300042591 Ga0466692_123665 Ga0466692_123665_909_1976 355
91 3300042606 Ga0466719_045356 Ga0466719_045356_175_1242 355
92 3300042652 Ga0466708_111835 Ga0466708_111835_2561_3628 355
93 3300042605 Ga0466716_208534 Ga0466716_208534_34_1140 356
94 3300042659 Ga0466733_074409 Ga0466733_074409_3000_4073 357
95 3300042612 Ga0466705_483465 Ga0466705_483465_3199_4278 359
96 3300042616 Ga0466715_242547 Ga0466715_242547_852_1931 359
97 3300005201 Ga0072941_1004616 Ga0072941_100461614 360
98 3300042590 Ga0466690_031567 Ga0466690_031567_32349_33434 361
99 3300042593 Ga0466691_167714 Ga0466691_167714_10928_12013 361
100 3300042636 Ga0466703_030252 Ga0466703_030252_24687_25772 361
101 3300042643 Ga0466704_319580 Ga0466704_319580_5274_6359 361
102 3300042648 Ga0466709_248107 Ga0466709_248107_13328_14413 361
103 3300042605 Ga0466716_088790 Ga0466716_088790_2664_3752 362
104 3300042620 Ga0466728_464196 Ga0466728_464196_1775_2863 362
105 3300042624 Ga0466735_155112 Ga0466735_155112_1158_2246 362
106 3300042596 Ga0466696_258149 Ga0466696_258149_318_1409 363
107 3300042606 Ga0466719_002263 Ga0466719_002263_393_1487 364
108 3300042615 Ga0466711_512790 Ga0466711_512790_3846_4946 366
109 3300042609 Ga0466722_205018 Ga0466722_205018_2076_3182 368
110 3300042616 Ga0466715_420933 Ga0466715_420933_3757_4866 369
111 3300042605 Ga0466716_166132 Ga0466716_166132_279_1394 371
112 3300042614 Ga0466712_181350 Ga0466712_181350_2941_4056 371
113 3300002449 JGI24698J34947_10012853 JGI24698J34947_100128531 372
114 3300009784 Ga0123357_10157882 Ga0123357_101578821 372
115 3300042648 Ga0466709_354862 Ga0466709_354862_3683_4822 372
116 3300042594 Ga0466694_234888 Ga0466694_234888_34_1158 374
117 3300042616 Ga0466715_097861 Ga0466715_097861_4669_5793 374
118 3300042643 Ga0466704_496283 Ga0466704_496283_575_1699 374
119 3300042615 Ga0466711_250165 Ga0466711_250165_38446_39594 382
120 3300042624 Ga0466735_204143 Ga0466735_204143_5934_7145 383
121 3300042593 Ga0466691_060495 Ga0466691_060495_3715_4887 390
122 3300042606 Ga0466719_432905 Ga0466719_432905_664_1851 395
123 3300042593 Ga0466691_199179 Ga0466691_199179_5619_6818 399
124 3300042659 Ga0466733_037501 Ga0466733_037501_423_1625 400
125 3300042618 Ga0466723_026659 Ga0466723_026659_12495_13700 401

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02608 Bmp ABC transporter substrate-binding protein PnrA-like 90 394 0.93

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02608 GO:0005886 plasma membrane CC

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.