Protein Family IF08002

Metagenome Isolate
210 Members
59 Samples
195 Scaffolds
383.34 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_023976|Ga0466723_023976_8783_10045
Length
420 aa
Sequence
MSDSGAPKSSIGNLIKNNIRNYSMFIMLAVIMVIFAFLTRGTNFNSRNFTNIFIQYSYVLILAVGMVQVIIIGGIDLSVGSVCAFVGAISVMVYNTGIGIIPTLLVALIIGAAIGAFQGFWIAYLQIPAFIVTLAGMLLFRGLTYIITKVNPINPHDDVYKQMASGFLNFPGLEIHYGGPIEGLRFGALPQELAGNFSIGTVYLSALLIGVIVAVLYIVTEIISRKNRLRNNFEVTPTPLFVGKVALISALVLFLSQRFSTYRGLPIVVIVLGVTIFIFNFIMKNTVLGRYIYAVGGNSRSAKLSGINSEQVVFIVFSIMGLLSGLAAVVSTGYMNSALPQAGNLFEMDAIAACYIGGVSASGGIGTVVGVIVGGLVMSAINNGMSLMNLGQHWQYVVKAAVVILAVLYDVYTRRKAGLG

📊 Sample Types

Isolate 7.1%
Metagenome 92.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 38.6%
Unclassified 24.6%
Kalotermitidae 24.6%
Rhinotermitidae 5.3%
Termopsidae 5.3%
Blaberidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 204
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
20 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
21 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
22 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
23 2772190975 Treponema sp. RmG30 Isolate Blaberidae
24 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
25 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
26 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
27 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
28 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
29 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
30 650716102 Treponema primitia ZAS-2 Isolate Unclassified
31 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
32 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
33 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
34 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
35 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
36 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
37 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
38 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
39 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
40 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
41 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
42 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
43 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
44 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
45 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
46 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
47 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
48 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
49 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
50 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
51 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
52 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
53 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
54 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
55 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
56 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
57 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
58 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
59 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0264413_100076 3300024493 Bacteria 24181
2 Ga0466690_015904 3300042590 Unclassified 5784
3 Ga0466692_043965 3300042591 Unclassified 19188
4 Ga0466691_217385 3300042593 Bacteria 8931
5 Ga0466720_067383 3300042607 Bacteria 28439
6 Ga0466720_067539 3300042607 Bacteria 32042
7 Ga0466711_033997 3300042615 Bacteria 50799
8 Ga0466711_428232 3300042615 Bacteria 12559
9 Ga0466715_363355 3300042616 Bacteria 5618
10 Ga0466718_026948 3300042617 Bacteria 7467
11 Ga0466726_034874 3300042619 Bacteria 3950
12 Ga0466726_049108 3300042619 Bacteria 43705
13 Ga0466726_355321 3300042619 Bacteria 4221
14 Ga0123356_10104675 3300010049 Bacteria 2721
15 Ga0123353_10182608 3300010167 Bacteria 3319
16 Ga0466702_112803 3300042635 Bacteria 14797
17 Ga0466703_145573 3300042636 Bacteria 9642
18 Ga0466704_017421 3300042643 Bacteria 7657
19 AustNasuHG_c1011582 3300000089 Bacteria 3055
20 JGI24695J34938_10000633 3300002450 Bacteria 33528
21 JGI24695J34938_10001271 3300002450 Bacteria 22126
22 JGI24695J34938_10001743 3300002450 Bacteria 17993
23 JGI24695J34938_10003164 3300002450 Bacteria 11705
24 JGI24695J34938_10005942 3300002450 Bacteria 7473
25 Ga0072940_1013799 3300005200 Bacteria 2361
26 Ga0466705_178158 3300042612 Bacteria 4877
27 Ga0466690_070876 3300042590 Bacteria 3259
28 Ga0466696_192598 3300042596 Bacteria 32112
29 Ga0466696_491409 3300042596 Bacteria 8739
30 Ga0466699_043442 3300042597 Bacteria 8955
31 Ga0466716_267588 3300042605 Bacteria 23240
32 Ga0466720_116513 3300042607 Bacteria 3916
33 Ga0466711_231064 3300042615 Bacteria 6764
34 Ga0466718_032597 3300042617 Bacteria 11747
35 Ga0466718_035945 3300042617 Bacteria 10291
36 Ga0466723_078763 3300042618 Bacteria 34371
37 Ga0466723_206850 3300042618 Bacteria 10211
38 Ga0466726_024892 3300042619 Bacteria 7975
39 Ga0466726_330965 3300042619 Bacteria 1644
40 Ga0466728_107607 3300042620 Bacteria 4059
41 Ga0466728_176296 3300042620 Bacteria 5491
42 Ga0466702_265266 3300042635 Bacteria 1908
43 Ga0466703_273161 3300042636 Bacteria 25534
44 Ga0466708_338472 3300042652 Bacteria 22312
45 AustNasuHG_c1016524 3300000089 Bacteria 2469
46 AustNasuHG_c1020649 3300000089 Bacteria 2142
47 AustNasuHG_c1025294 3300000089 Bacteria 1866
48 JGI24698J34947_10003991 3300002449 Bacteria 8028
49 JGI24695J34938_10000083 3300002450 Bacteria 81347
50 JGI24702J35022_10016095 3300002462 Bacteria 4106
51 Ga0466705_250306 3300042612 Bacteria 6601
52 Ga0466733_111851 3300042659 Bacteria 82439
53 Ga0466690_023641 3300042590 Bacteria 16783
54 Ga0466690_339345 3300042590 Bacteria 11574
55 Ga0466692_056577 3300042591 Bacteria 3337
56 Ga0466693_272310 3300042592 Bacteria 2127
57 Ga0466691_001134 3300042593 Bacteria 9308
58 Ga0466694_070404 3300042594 Bacteria 1879
59 Ga0466716_292325 3300042605 Bacteria 4529
60 Ga0466719_194349 3300042606 Bacteria 5958
61 Ga0466719_448303 3300042606 Bacteria 4461
62 Ga0466712_059606 3300042614 Bacteria 1406
63 Ga0466715_098926 3300042616 Bacteria 8676
64 Ga0466723_222530 3300042618 Bacteria 8667
65 Ga0466726_480645 3300042619 Bacteria 2902
66 Ga0123355_10198061 3300009826 Bacteria 2941
67 Ga0123353_10112513 3300010167 Bacteria 4383
68 Ga0466731_047750 3300042622 Bacteria 1837
69 Ga0466703_002994 3300042636 Bacteria 7986
70 Ga0466727_212494 3300042655 Bacteria 13739
71 AustNasuHG_c1001779 3300000089 Bacteria 7805
72 JGI24695J34938_10000820 3300002450 Bacteria 28898
73 JGI24695J34938_10007653 3300002450 Bacteria 6278
74 JGI24695J34938_10022659 3300002450 Bacteria 3044
75 Ga0466705_118364 3300042612 Bacteria 19256
76 Ga0466732_088174 3300042656 Bacteria 4289
77 Ga0466732_362147 3300042656 Bacteria 2389
78 Ga0466692_070894 3300042591 Bacteria 5338
79 Ga0466692_074346 3300042591 Bacteria 18199
80 Ga0466692_182822 3300042591 Unclassified 2530
81 Ga0466691_049649 3300042593 Bacteria 12533
82 Ga0466691_121772 3300042593 Bacteria 1666
83 Ga0466719_007530 3300042606 Unclassified 6954
84 Ga0466720_063073 3300042607 Bacteria 19134
85 Ga0466720_129485 3300042607 Bacteria 14228
86 Ga0466715_547327 3300042616 Bacteria 4968
87 Ga0466723_076075 3300042618 Bacteria 14573
88 Ga0466726_003768 3300042619 Bacteria 3831
89 Ga0466726_058764 3300042619 Bacteria 2181
90 Ga0466703_000505 3300042636 Bacteria 2159
91 Ga0466703_023864 3300042636 Bacteria 16522
92 Ga0466704_058561 3300042643 Bacteria 6264
93 Ga0466704_083456 3300042643 Bacteria 4555
94 Ga0466709_215991 3300042648 Bacteria 21139
95 Ga0466727_028484 3300042655 Bacteria 6220
96 Ga0466705_016508 3300042612 Bacteria 4496
97 Ga0466732_115342 3300042656 Bacteria 1625
98 Ga0466690_047607 3300042590 Bacteria 17366
99 Ga0466692_108157 3300042591 Bacteria 26610
100 Ga0466691_068317 3300042593 Bacteria 43845
101 Ga0466694_194070 3300042594 Bacteria 1246
102 Ga0466694_329436 3300042594 Bacteria 3286
103 Ga0466720_054034 3300042607 Bacteria 19093
104 Ga0466722_135202 3300042609 Bacteria 7444
105 Ga0466712_318684 3300042614 Bacteria 5026
106 Ga0466711_184001 3300042615 Bacteria 24586
107 Ga0466711_409913 3300042615 Unclassified 4074
108 Ga0466715_068985 3300042616 Bacteria 29330
109 Ga0466715_590522 3300042616 Bacteria 2168
110 Ga0466723_243195 3300042618 Bacteria 87629
111 Ga0466728_036367 3300042620 Bacteria 7264
112 Ga0123357_10056769 3300009784 Bacteria 5264
113 Ga0123356_10002389 3300010049 Bacteria 20099
114 Ga0123353_10020088 3300010167 Bacteria 9961
115 Ga0466735_067876 3300042624 Bacteria 19585
116 Ga0466703_083947 3300042636 Bacteria 12791
117 Ga0466703_216415 3300042636 Bacteria 22191
118 Ga0466727_221321 3300042655 Bacteria 1449
119 Ga0466705_023597 3300042612 Bacteria 9313
120 Ga0466727_351835 3300042655 Bacteria 23710
121 Ga0264413_100027 3300024493 Bacteria 30442
122 Ga0466690_270804 3300042590 Bacteria 7583
123 Ga0466691_030299 3300042593 Bacteria 7416
124 Ga0466696_204246 3300042596 Bacteria 14923
125 Ga0466700_390491 3300042600 Bacteria 1644
126 Ga0466707_418121 3300042601 Bacteria 3613
127 Ga0466716_072069 3300042605 Bacteria 16699
128 Ga0466720_025670 3300042607 Bacteria 4699
129 Ga0466698_451569 3300042610 Bacteria 3201
130 Ga0466712_079378 3300042614 Bacteria 31085
131 Ga0466715_068797 3300042616 Bacteria 13415
132 Ga0466726_023563 3300042619 Bacteria 3133
133 Ga0466728_044878 3300042620 Bacteria 9100
134 Ga0123356_10164501 3300010049 Bacteria 2221
135 Ga0466704_523983 3300042643 Bacteria 32009
136 Ga0466709_416555 3300042648 Bacteria 26652
137 Ga0466727_033611 3300042655 Bacteria 2348
138 Ga0466727_107613 3300042655 Bacteria 1551
139 JGI24695J34938_10025164 3300002450 Bacteria 2849
140 JGI24702J35022_10098087 3300002462 Bacteria 1601
141 Ga0466705_199691 3300042612 Bacteria 25313
142 Ga0466705_241169 3300042612 Bacteria 18952
143 Ga0466733_033224 3300042659 Bacteria 2275
144 Ga0466733_046948 3300042659 Bacteria 19911
145 Ga0466733_130414 3300042659 Bacteria 1762
146 Ga0466691_088494 3300042593 Bacteria 33612
147 Ga0466707_038490 3300042601 Bacteria 2569
148 Ga0466719_099812 3300042606 Bacteria 30019
149 Ga0466719_260373 3300042606 Bacteria 26617
150 Ga0466722_055897 3300042609 Bacteria 3161
151 Ga0466712_037219 3300042614 Bacteria 9147
152 Ga0466715_152603 3300042616 Unclassified 4340
153 Ga0466718_001438 3300042617 Bacteria 5265
154 Ga0466718_060021 3300042617 Bacteria 7007
155 Ga0466718_110221 3300042617 Bacteria 1517
156 Ga0466723_023976 3300042618 Bacteria 16798
157 Ga0466723_049340 3300042618 Bacteria 19117
158 Ga0466723_069398 3300042618 Bacteria 18161
159 Ga0466726_059745 3300042619 Bacteria 1884
160 Ga0466726_135186 3300042619 Bacteria 1664
161 Ga0466729_192345 3300042621 Bacteria 3083
162 Ga0466729_317009 3300042621 Bacteria 1291
163 Ga0466702_131151 3300042635 Bacteria 8127
164 Ga0466703_212543 3300042636 Bacteria 7261
165 Ga0466704_137481 3300042643 Bacteria 6754
166 Ga0466704_263754 3300042643 Bacteria 34688
167 Ga0466704_320787 3300042643 Bacteria 9317
168 Ga0466704_378265 3300042643 Bacteria 4465
169 Ga0466704_412370 3300042643 Bacteria 1579
170 Ga0466708_028790 3300042652 Bacteria 17651
171 AustNasuHG_c1000021 3300000089 Bacteria 36984
172 AustNasuHG_c1000794 3300000089 Bacteria 11302
173 AustNasuHG_c1003774 3300000089 Bacteria 5466
174 JGI24698J34947_10025465 3300002449 Bacteria 3149
175 JGI24695J34938_10000501 3300002450 Bacteria 38048
176 JGI24695J34938_10001997 3300002450 Bacteria 16223
177 Ga0466705_249703 3300042612 Bacteria 2565
178 Ga0466732_317894 3300042656 Bacteria 3783
179 Ga0466694_051267 3300042594 Bacteria 1771
180 Ga0466694_363511 3300042594 Bacteria 12599
181 Ga0466696_053288 3300042596 Bacteria 21014
182 Ga0466699_071821 3300042597 Bacteria 9185
183 Ga0466699_154994 3300042597 Bacteria 10048
184 Ga0466717_037086 3300042604 Bacteria 2015
185 Ga0466719_079961 3300042606 Bacteria 4371
186 Ga0466722_207506 3300042609 Bacteria 18414
187 Ga0466698_127505 3300042610 Bacteria 18075
188 Ga0466718_107921 3300042617 Bacteria 23746
189 Ga0466726_493850 3300042619 Bacteria 5575
190 Ga0466728_029450 3300042620 Bacteria 3535
191 Ga0123356_10003564 3300010049 Bacteria 16261
192 Ga0466708_261397 3300042652 Bacteria 1525
193 Ga0466727_040208 3300042655 Bacteria 4244
194 JGI24702J35022_10000405 3300002462 Bacteria 25725
195 Ga0072941_1009078 3300005201 Bacteria 22637

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042591 Ga0466692_182822 Ga0466692_182822_30_947 305
2 3300042607 Ga0466720_116513 Ga0466720_116513_25_1035 336
3 3300042617 Ga0466718_060021 Ga0466718_060021_5709_6914 336
4 3300042607 Ga0466720_025670 Ga0466720_025670_3662_4675 337
5 3300002450 JGI24695J34938_10001997 JGI24695J34938_100019979 338
6 3300042592 Ga0466693_272310 Ga0466693_272310_1077_2099 340
7 3300042636 Ga0466703_000505 Ga0466703_000505_12_1034 340
8 3300042600 Ga0466700_390491 Ga0466700_390491_95_1222 342
9 3300042615 Ga0466711_231064 Ga0466711_231064_4935_6053 342
10 3300002450 JGI24695J34938_10000501 JGI24695J34938_100005015 343
11 3300042612 Ga0466705_023597 Ga0466705_023597_6810_7997 348
12 3300042612 Ga0466705_250306 Ga0466705_250306_478_1575 349
13 3300042635 Ga0466702_112803 Ga0466702_112803_184_1380 349
14 3300042655 Ga0466727_033611 Ga0466727_033611_54_1154 349
15 3300042610 Ga0466698_451569 Ga0466698_451569_1173_2366 352
16 3300002450 JGI24695J34938_10007653 JGI24695J34938_100076535 354
17 3300010049 Ga0123356_10104675 Ga0123356_101046752 356
18 3300042619 Ga0466726_024892 Ga0466726_024892_6233_7435 359
19 3300042636 Ga0466703_273161 Ga0466703_273161_19433_20560 361
20 3300009826 Ga0123355_10198061 Ga0123355_101980612 362
21 3300042619 Ga0466726_493850 Ga0466726_493850_2309_3502 363
22 3300042621 Ga0466729_192345 Ga0466729_192345_1403_2575 363
23 3300000089 AustNasuHG_c1000021 AustNasuHG_100002110 364
24 3300042607 Ga0466720_067539 Ga0466720_067539_5896_7092 364
25 3300010049 Ga0123356_10003564 Ga0123356_100035649 365
26 3300042594 Ga0466694_051267 Ga0466694_051267_395_1531 365
27 3300042635 Ga0466702_265266 Ga0466702_265266_667_1863 365
28 3300002450 JGI24695J34938_10001743 JGI24695J34938_1000174313 366
29 3300042590 Ga0466690_339345 Ga0466690_339345_8424_9617 366
30 3300042593 Ga0466691_030299 Ga0466691_030299_4241_5362 366
31 3300042616 Ga0466715_068985 Ga0466715_068985_19734_20927 366
32 3300042616 Ga0466715_152603 Ga0466715_152603_1071_2204 366
33 3300042590 Ga0466690_070876 Ga0466690_070876_37_1230 367
34 3300042591 Ga0466692_043965 Ga0466692_043965_6562_7665 367
35 3300042615 Ga0466711_409913 Ga0466711_409913_1527_2714 367
36 3300042636 Ga0466703_002994 Ga0466703_002994_5399_6586 367
37 3300042659 Ga0466733_111851 Ga0466733_111851_65595_66782 367
38 3300042590 Ga0466690_015904 Ga0466690_015904_1387_2580 368
39 3300002450 JGI24695J34938_10025164 JGI24695J34938_100251643 369
40 3300042616 Ga0466715_098926 Ga0466715_098926_5199_6392 369
41 3300042624 Ga0466735_067876 Ga0466735_067876_17225_18418 369
42 3300042607 Ga0466720_063073 Ga0466720_063073_44_1156 370
43 3300042643 Ga0466704_378265 Ga0466704_378265_151_1374 371
44 3300042605 Ga0466716_267588 Ga0466716_267588_4413_5597 372
45 3300042659 Ga0466733_033224 Ga0466733_033224_934_2121 372
46 3300042591 Ga0466692_074346 Ga0466692_074346_10_1131 373
47 3300042619 Ga0466726_059745 Ga0466726_059745_391_1512 373
48 3300042652 Ga0466708_261397 Ga0466708_261397_211_1332 373
49 3300010167 Ga0123353_10112513 Ga0123353_101125133 374
50 3300042612 Ga0466705_178158 Ga0466705_178158_3398_4591 374
51 3300042643 Ga0466704_083456 Ga0466704_083456_668_1861 374
52 3300042596 Ga0466696_192598 Ga0466696_192598_14251_15435 375
53 3300042596 Ga0466696_204246 Ga0466696_204246_9885_11069 375
54 3300042605 Ga0466716_292325 Ga0466716_292325_3128_4255 375
55 3300042615 Ga0466711_428232 Ga0466711_428232_291_1484 375
56 3300042616 Ga0466715_590522 Ga0466715_590522_777_1970 375
57 3300010049 Ga0123356_10164501 Ga0123356_101645011 376
58 3300042618 Ga0466723_243195 Ga0466723_243195_59296_60426 376
59 3300042619 Ga0466726_480645 Ga0466726_480645_974_2104 376
60 3300042659 Ga0466733_130414 Ga0466733_130414_80_1267 376
61 3300042594 Ga0466694_363511 Ga0466694_363511_3334_4530 377
62 3300042604 Ga0466717_037086 Ga0466717_037086_91_1287 377
63 3300042618 Ga0466723_076075 Ga0466723_076075_8519_9712 377
64 3300042619 Ga0466726_355321 Ga0466726_355321_96_1289 377
65 3300042643 Ga0466704_137481 Ga0466704_137481_4309_5484 377
66 3300000089 AustNasuHG_c1020649 AustNasuHG_10206492 378
67 3300010049 Ga0123356_10002389 Ga0123356_1000238911 378
68 3300042591 Ga0466692_070894 Ga0466692_070894_3059_4231 378
69 3300042601 Ga0466707_038490 Ga0466707_038490_903_2093 378
70 3300042607 Ga0466720_054034 Ga0466720_054034_1298_2434 378
71 3300042607 Ga0466720_067383 Ga0466720_067383_26006_27142 378
72 3300042607 Ga0466720_129485 Ga0466720_129485_4961_6097 378
73 3300042614 Ga0466712_079378 Ga0466712_079378_15404_16606 378
74 3300042616 Ga0466715_547327 Ga0466715_547327_468_1661 378
75 3300042617 Ga0466718_026948 Ga0466718_026948_513_1649 378
76 3300042617 Ga0466718_032597 Ga0466718_032597_970_2106 378
77 iso_pr_bacteria 2819992462 2819993996 378
78 iso_pr_bacteria 2819992462 2819994295 378
79 3300002450 JGI24695J34938_10003164 JGI24695J34938_100031643 379
80 3300002462 JGI24702J35022_10098087 JGI24702J35022_100980871 380
81 3300010167 Ga0123353_10182608 Ga0123353_101826083 380
82 3300042619 Ga0466726_330965 Ga0466726_330965_127_1326 380
83 3300042620 Ga0466728_036367 Ga0466728_036367_3097_4299 380
84 3300042622 Ga0466731_047750 Ga0466731_047750_443_1639 380
85 3300002450 JGI24695J34938_10005942 JGI24695J34938_100059423 381
86 3300042591 Ga0466692_108157 Ga0466692_108157_13921_15093 381
87 3300042597 Ga0466699_043442 Ga0466699_043442_1161_2360 381
88 3300042597 Ga0466699_071821 Ga0466699_071821_7525_8724 381
89 3300042659 Ga0466733_046948 Ga0466733_046948_15702_16892 381
90 3300024493 Ga0264413_100027 Ga0264413_10002726 383
91 3300042618 Ga0466723_049340 Ga0466723_049340_4011_5201 383
92 3300042621 Ga0466729_317009 Ga0466729_317009_16_1206 383
93 3300042635 Ga0466702_131151 Ga0466702_131151_4150_5343 383
94 3300042594 Ga0466694_194070 Ga0466694_194070_14_1210 384
95 3300002450 JGI24695J34938_10000633 JGI24695J34938_1000063317 385
96 3300002462 JGI24702J35022_10016095 JGI24702J35022_100160952 385
97 3300005201 Ga0072941_1009078 Ga0072941_10090789 385
98 3300042594 Ga0466694_070404 Ga0466694_070404_305_1501 385
99 3300042614 Ga0466712_037219 Ga0466712_037219_379_1575 385
100 3300042614 Ga0466712_059606 Ga0466712_059606_123_1319 385
101 3300042614 Ga0466712_318684 Ga0466712_318684_345_1541 385
102 3300042617 Ga0466718_001438 Ga0466718_001438_3158_4354 385
103 3300042617 Ga0466718_110221 Ga0466718_110221_190_1386 385
104 3300002449 JGI24698J34947_10025465 JGI24698J34947_100254652 386
105 3300024493 Ga0264413_100076 Ga0264413_10007622 386
106 3300042606 Ga0466719_079961 Ga0466719_079961_1621_2814 386
107 3300042612 Ga0466705_249703 Ga0466705_249703_188_1381 386
108 3300042615 Ga0466711_184001 Ga0466711_184001_8250_9434 386
109 3300002449 JGI24698J34947_10003991 JGI24698J34947_100039916 387
110 3300002450 JGI24695J34938_10000083 JGI24695J34938_1000008343 387
111 3300002450 JGI24695J34938_10022659 JGI24695J34938_100226592 387
112 3300042609 Ga0466722_207506 Ga0466722_207506_7734_8921 387
113 3300042617 Ga0466718_035945 Ga0466718_035945_4864_6060 387
114 3300042618 Ga0466723_069398 Ga0466723_069398_11540_12724 387
115 3300042636 Ga0466703_145573 Ga0466703_145573_3974_5170 387
116 3300002450 JGI24695J34938_10001271 JGI24695J34938_1000127121 388
117 3300042593 Ga0466691_217385 Ga0466691_217385_3181_4371 388
118 3300042601 Ga0466707_418121 Ga0466707_418121_1542_2735 389
119 3300042606 Ga0466719_099812 Ga0466719_099812_14345_15541 389
120 3300042612 Ga0466705_118364 Ga0466705_118364_3766_4962 389
121 3300042643 Ga0466704_523983 Ga0466704_523983_17039_18235 389
122 3300042612 Ga0466705_241169 Ga0466705_241169_7625_8818 390
123 3300042636 Ga0466703_023864 Ga0466703_023864_1152_2375 390
124 3300042636 Ga0466703_216415 Ga0466703_216415_15231_16448 390
125 3300042643 Ga0466704_263754 Ga0466704_263754_11082_12275 390
126 3300002450 JGI24695J34938_10000820 JGI24695J34938_1000082013 391
127 3300042593 Ga0466691_088494 Ga0466691_088494_14054_15253 391
128 3300042593 Ga0466691_121772 Ga0466691_121772_350_1546 391
129 3300042617 Ga0466718_107921 Ga0466718_107921_10209_11414 391
130 3300042618 Ga0466723_222530 Ga0466723_222530_7363_8586 391
131 3300042619 Ga0466726_135186 Ga0466726_135186_119_1300 393
132 3300000089 AustNasuHG_c1003774 AustNasuHG_10037743 394
133 3300042590 Ga0466690_270804 Ga0466690_270804_3299_4483 394
134 3300042593 Ga0466691_068317 Ga0466691_068317_35799_36983 394
135 3300042596 Ga0466696_053288 Ga0466696_053288_12581_13765 394
136 3300042606 Ga0466719_194349 Ga0466719_194349_3494_4678 394
137 3300042609 Ga0466722_055897 Ga0466722_055897_1384_2568 394
138 3300042609 Ga0466722_135202 Ga0466722_135202_4161_5345 394
139 3300042612 Ga0466705_016508 Ga0466705_016508_371_1555 394
140 3300042619 Ga0466726_034874 Ga0466726_034874_2748_3932 394
141 3300042643 Ga0466704_017421 Ga0466704_017421_3378_4562 394
142 3300042643 Ga0466704_412370 Ga0466704_412370_188_1372 394
143 3300042652 Ga0466708_028790 Ga0466708_028790_9421_10605 394
144 3300042619 Ga0466726_049108 Ga0466726_049108_13871_15058 395
145 3300042648 Ga0466709_416555 Ga0466709_416555_5693_6895 395
146 3300042655 Ga0466727_351835 Ga0466727_351835_8176_9363 395
147 3300042656 Ga0466732_362147 Ga0466732_362147_417_1625 395
148 3300042619 Ga0466726_023563 Ga0466726_023563_985_2175 396
149 3300042619 Ga0466726_058764 Ga0466726_058764_515_1705 396
150 3300042620 Ga0466728_029450 Ga0466728_029450_1932_3122 396
151 3300042643 Ga0466704_058561 Ga0466704_058561_147_1337 396
152 3300042655 Ga0466727_040208 Ga0466727_040208_1689_2879 396
153 3300042655 Ga0466727_107613 Ga0466727_107613_175_1365 396
154 3300042655 Ga0466727_221321 Ga0466727_221321_179_1369 396
155 iso_pr_bacteria 2772190975 2773724036 396
156 3300000089 AustNasuHG_c1001779 AustNasuHG_10017793 397
157 3300042619 Ga0466726_003768 Ga0466726_003768_2472_3698 397
158 3300042648 Ga0466709_215991 Ga0466709_215991_2508_3701 397
159 iso_pr_bacteria 650716099 650877672 397
160 iso_pr_bacteria 650716102 650881814 397
161 3300042594 Ga0466694_329436 Ga0466694_329436_1270_2466 398
162 3300042597 Ga0466699_154994 Ga0466699_154994_4367_5563 398
163 3300042610 Ga0466698_127505 Ga0466698_127505_7363_8559 398
164 3300042643 Ga0466704_320787 Ga0466704_320787_19_1242 398
165 3300042656 Ga0466732_115342 Ga0466732_115342_194_1390 398
166 3300042656 Ga0466732_317894 Ga0466732_317894_1999_3195 398
167 iso_pr_bacteria 2781125631 2781269270 398
168 iso_pr_bacteria 2781125636 2781279808 398
169 iso_pr_bacteria 2781125638 2781283912 398
170 iso_pr_bacteria 2781125641 2781290456 398
171 iso_pr_bacteria 2781125642 2781292644 398
172 iso_pr_bacteria 2781125646 2781300881 398
173 iso_pr_bacteria 2781125647 2781303425 398
174 iso_pr_bacteria 2781125657 2781322447 398
175 iso_pr_bacteria 2781125658 2781325650 398
176 iso_pr_bacteria 2781125691 2781429573 398
177 3300002462 JGI24702J35022_10000405 JGI24702J35022_100004054 399
178 3300010167 Ga0123353_10020088 Ga0123353_100200887 399
179 3300042606 Ga0466719_448303 Ga0466719_448303_1082_2281 399
180 3300042616 Ga0466715_068797 Ga0466715_068797_7413_8612 399
181 3300042616 Ga0466715_363355 Ga0466715_363355_2434_3633 399
182 3300042652 Ga0466708_338472 Ga0466708_338472_12272_13471 399
183 3300042655 Ga0466727_028484 Ga0466727_028484_2627_3826 399
184 3300042655 Ga0466727_212494 Ga0466727_212494_251_1450 399
185 3300042590 Ga0466690_023641 Ga0466690_023641_7345_8547 400
186 3300042593 Ga0466691_049649 Ga0466691_049649_6005_7207 400
187 3300042605 Ga0466716_072069 Ga0466716_072069_7085_8287 400
188 3300042606 Ga0466719_260373 Ga0466719_260373_5692_6894 400
189 3300042612 Ga0466705_199691 Ga0466705_199691_9656_10858 400
190 3300042615 Ga0466711_033997 Ga0466711_033997_12621_13823 400
191 3300042618 Ga0466723_078763 Ga0466723_078763_12284_13486 400
192 3300042620 Ga0466728_044878 Ga0466728_044878_134_1357 400
193 3300042636 Ga0466703_212543 Ga0466703_212543_2859_4061 400
194 3300042591 Ga0466692_056577 Ga0466692_056577_1336_2541 401
195 3300042656 Ga0466732_088174 Ga0466732_088174_1070_2275 401
196 3300000089 AustNasuHG_c1000794 AustNasuHG_10007949 402
197 3300000089 AustNasuHG_c1011582 AustNasuHG_10115822 402
198 3300000089 AustNasuHG_c1025294 AustNasuHG_10252942 402
199 3300005200 Ga0072940_1013799 Ga0072940_10137991 402
200 3300000089 AustNasuHG_c1016524 AustNasuHG_10165242 403
201 3300042606 Ga0466719_007530 Ga0466719_007530_1519_2781 406
202 3300042596 Ga0466696_491409 Ga0466696_491409_4434_5657 407
203 3300042618 Ga0466723_206850 Ga0466723_206850_5709_6932 407
204 3300042620 Ga0466728_107607 Ga0466728_107607_2740_3963 407
205 3300042620 Ga0466728_176296 Ga0466728_176296_1075_2298 407
206 3300009784 Ga0123357_10056769 Ga0123357_100567695 418
207 3300042590 Ga0466690_047607 Ga0466690_047607_13337_14599 420
208 3300042593 Ga0466691_001134 Ga0466691_001134_6672_7934 420
209 3300042618 Ga0466723_023976 Ga0466723_023976_8783_10045 420
210 3300042636 Ga0466703_083947 Ga0466703_083947_5370_6632 420

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02653 BPD_transp_2 Branched-chain amino acid transport system / permease component 49 217 0.82

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.91 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.