Protein Family IF08000

Metagenome Isolate
120 Members
35 Samples
116 Scaffolds
204.09 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_022565|Ga0466723_022565_2488_3189
Length
233 aa
Sequence
VEFGVPLITKSPDSAGVGIRDDGKYHFQEKTMKELTQRQREVLTFISDYIRSHYYPPTIREVAEHFSISVKGAYDHVLALKKKGRLKLDDKRSRTMEVVHDEEDRAIEGFAEIRVLGVVAAGRPILAEENWDGSIPMHNSFLKKNKQYFALKVKGDSMKDAGILDKDTALIQEQDFARNGEIVVAVVDEAVTLKRFFKETNRIRLQPENPAYLPIYSQDVRILGKLAHIIRSY

📊 Sample Types

Isolate 3.3%
Metagenome 96.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 40.0%
Termitidae 31.4%
Unclassified 14.3%
Termopsidae 8.6%
Rhinotermitidae 5.7%

🌳 Taxonomy

Archaea 0
Bacteria 113
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
4 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
5 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
8 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
15 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
16 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
17 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
18 650716102 Treponema primitia ZAS-2 Isolate Unclassified
19 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
20 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
21 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
22 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
23 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
24 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
25 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
26 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
27 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
28 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
29 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
30 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
31 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
32 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
33 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
34 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
35 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466690_001340 3300042590 Unclassified 1287
2 Ga0466702_222629 3300042635 Bacteria 24290
3 Ga0466703_103947 3300042636 Bacteria 2447
4 Ga0466708_008318 3300042652 Bacteria 7020
5 Ga0466708_155816 3300042652 Bacteria 23783
6 Ga0466708_232686 3300042652 Bacteria 4683
7 Ga0466700_325490 3300042600 Bacteria 1329
8 Ga0466719_033519 3300042606 Bacteria 1479
9 Ga0466719_499064 3300042606 Bacteria 1103
10 Ga0466719_558470 3300042606 Unclassified 1518
11 Ga0466715_481844 3300042616 Bacteria 7971
12 Ga0466723_271934 3300042618 Bacteria 6848
13 Ga0466705_104098 3300042612 Bacteria 9560
14 Ga0466691_142615 3300042593 Bacteria 2689
15 Ga0466696_006913 3300042596 Bacteria 1612
16 Ga0466696_179878 3300042596 Bacteria 10124
17 Ga0466701_006364 3300042598 Bacteria 1410
18 Ga0466731_247662 3300042622 Bacteria 2971
19 Ga0466735_002079 3300042624 Bacteria 1368
20 Ga0466735_020895 3300042624 Bacteria 1051
21 Ga0466702_406002 3300042635 Bacteria 2704
22 Ga0466704_107342 3300042643 Bacteria 3149
23 Ga0466708_002668 3300042652 Bacteria 9345
24 Ga0466727_048067 3300042655 Bacteria 1092
25 Ga0466712_039319 3300042614 Bacteria 3409
26 Ga0466715_131105 3300042616 Bacteria 7317
27 Ga0466715_463170 3300042616 Bacteria 10845
28 Ga0466726_166077 3300042619 Bacteria 2576
29 JGI24698J34947_10050093 3300002449 Bacteria 2108
30 Ga0466705_019389 3300042612 Bacteria 5246
31 Ga0466705_218629 3300042612 Bacteria 9461
32 Ga0466696_386021 3300042596 Bacteria 12033
33 Ga0466699_184149 3300042597 Bacteria 40447
34 Ga0123357_10014743 3300009784 Bacteria 10216
35 Ga0466735_122506 3300042624 Bacteria 3724
36 Ga0466704_228684 3300042643 Bacteria 10063
37 Ga0466704_286001 3300042643 Bacteria 16185
38 Ga0466708_030492 3300042652 Bacteria 4198
39 Ga0466707_382239 3300042601 Bacteria 1045
40 Ga0466716_143072 3300042605 Bacteria 4672
41 Ga0466719_085927 3300042606 Bacteria 3528
42 Ga0466711_308150 3300042615 Bacteria 3935
43 Ga0466711_497397 3300042615 Bacteria 2618
44 Ga0466715_226275 3300042616 Bacteria 9542
45 Ga0466715_278389 3300042616 Bacteria 5972
46 Ga0466723_226588 3300042618 Bacteria 6206
47 JGI24698J34947_10002415 3300002449 Bacteria 10058
48 Ga0466705_340330 3300042612 Bacteria 7504
49 Ga0466690_040742 3300042590 Bacteria 2139
50 Ga0466690_078911 3300042590 Bacteria 1130
51 Ga0466735_133048 3300042624 Bacteria 2145
52 Ga0466702_126621 3300042635 Bacteria 1108
53 Ga0466703_072716 3300042636 Bacteria 8555
54 Ga0466709_050417 3300042648 Bacteria 2900
55 Ga0466707_206027 3300042601 Bacteria 1256
56 Ga0466716_051618 3300042605 Bacteria 17911
57 Ga0466715_312142 3300042616 Bacteria 12836
58 Ga0466718_036178 3300042617 Bacteria 12806
59 Ga0466723_017798 3300042618 Bacteria 9159
60 Ga0466723_022565 3300042618 Bacteria 4838
61 Ga0466728_459854 3300042620 Bacteria 3008
62 Ga0466705_083290 3300042612 Unclassified 1462
63 Ga0466691_047050 3300042593 Bacteria 5769
64 Ga0466702_436602 3300042635 Bacteria 2154
65 Ga0466703_035407 3300042636 Bacteria 9054
66 Ga0466704_161524 3300042643 Bacteria 7948
67 Ga0466704_224322 3300042643 Bacteria 1138
68 Ga0466704_302653 3300042643 Bacteria 5475
69 Ga0466704_549246 3300042643 Bacteria 8888
70 Ga0466709_381365 3300042648 Bacteria 28038
71 Ga0466708_020095 3300042652 Bacteria 10835
72 Ga0466719_520969 3300042606 Bacteria 1882
73 Ga0466712_117371 3300042614 Bacteria 5748
74 Ga0466728_191092 3300042620 Unclassified 1885
75 Ga0466728_258415 3300042620 Bacteria 5628
76 Ga0466729_134193 3300042621 Bacteria 1205
77 Ga0466690_135457 3300042590 Unclassified 1126
78 Ga0466690_303226 3300042590 Unclassified 3480
79 Ga0466695_063524 3300042595 Bacteria 5477
80 Ga0123354_10016977 3300010882 Bacteria 11402
81 Ga0466729_199377 3300042621 Bacteria 4237
82 Ga0466735_037440 3300042624 Bacteria 20852
83 Ga0466703_116071 3300042636 Bacteria 5249
84 Ga0466703_239484 3300042636 Unclassified 1579
85 Ga0466704_484696 3300042643 Bacteria 5878
86 Ga0466709_159197 3300042648 Bacteria 4476
87 Ga0466708_066838 3300042652 Bacteria 32818
88 Ga0466708_343097 3300042652 Bacteria 24340
89 Ga0466722_090488 3300042609 Bacteria 1337
90 Ga0466722_118888 3300042609 Bacteria 12085
91 JGI24698J34947_10039042 3300002449 Bacteria 2460
92 Ga0466735_065722 3300042624 Bacteria 2544
93 Ga0466703_286328 3300042636 Bacteria 2389
94 Ga0466709_068755 3300042648 Bacteria 5487
95 Ga0466707_199385 3300042601 Bacteria 1527
96 Ga0466716_370062 3300042605 Bacteria 1560
97 Ga0466719_352927 3300042606 Bacteria 1138
98 Ga0466719_375505 3300042606 Bacteria 1474
99 Ga0466715_049424 3300042616 Bacteria 22983
100 Ga0466715_338445 3300042616 Bacteria 17601
101 Ga0466705_181501 3300042612 Bacteria 1639
102 Ga0466690_389635 3300042590 Bacteria 2334
103 Ga0466696_340779 3300042596 Bacteria 5891
104 Ga0466703_413370 3300042636 Bacteria 9727
105 Ga0466704_144518 3300042643 Bacteria 13573
106 Ga0466709_179037 3300042648 Bacteria 19623
107 Ga0466709_331902 3300042648 Bacteria 6314
108 Ga0466708_025410 3300042652 Bacteria 1670
109 Ga0466727_163476 3300042655 Bacteria 6512
110 Ga0466707_180530 3300042601 Bacteria 1490
111 Ga0466719_125550 3300042606 Bacteria 2385
112 Ga0466715_314204 3300042616 Bacteria 4723
113 Ga0466723_038166 3300042618 Bacteria 5521
114 Ga0466723_139730 3300042618 Bacteria 2636
115 Ga0466723_260693 3300042618 Bacteria 3433
116 Ga0466728_007132 3300042620 Bacteria 16135

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_135457 Ga0466690_135457_592_1107 171
2 3300042652 Ga0466708_155816 Ga0466708_155816_16885_17418 177
3 3300042596 Ga0466696_340779 Ga0466696_340779_4673_5263 196
4 3300042598 Ga0466701_006364 Ga0466701_006364_773_1381 196
5 3300042590 Ga0466690_303226 Ga0466690_303226_2390_2995 201
6 3300042596 Ga0466696_179878 Ga0466696_179878_3894_4499 201
7 3300042597 Ga0466699_184149 Ga0466699_184149_38664_39269 201
8 3300042612 Ga0466705_104098 Ga0466705_104098_6146_6751 201
9 3300042614 Ga0466712_117371 Ga0466712_117371_4182_4787 201
10 3300042615 Ga0466711_308150 Ga0466711_308150_359_964 201
11 3300042615 Ga0466711_497397 Ga0466711_497397_1965_2570 201
12 3300042616 Ga0466715_049424 Ga0466715_049424_20049_20654 201
13 3300042616 Ga0466715_314204 Ga0466715_314204_1798_2403 201
14 3300042617 Ga0466718_036178 Ga0466718_036178_2259_2864 201
15 3300042618 Ga0466723_226588 Ga0466723_226588_1111_1716 201
16 3300042618 Ga0466723_271934 Ga0466723_271934_2771_3376 201
17 3300042620 Ga0466728_007132 Ga0466728_007132_14634_15239 201
18 3300042620 Ga0466728_459854 Ga0466728_459854_1587_2192 201
19 3300042635 Ga0466702_222629 Ga0466702_222629_8275_8880 201
20 3300042635 Ga0466702_406002 Ga0466702_406002_702_1307 201
21 3300042635 Ga0466702_436602 Ga0466702_436602_1454_2059 201
22 3300042636 Ga0466703_072716 Ga0466703_072716_4478_5083 201
23 3300042643 Ga0466704_161524 Ga0466704_161524_4535_5140 201
24 3300042643 Ga0466704_549246 Ga0466704_549246_4229_4834 201
25 3300042648 Ga0466709_179037 Ga0466709_179037_10413_11018 201
26 3300042652 Ga0466708_020095 Ga0466708_020095_4250_4855 201
27 3300002449 JGI24698J34947_10002415 JGI24698J34947_100024152 202
28 3300042590 Ga0466690_001340 Ga0466690_001340_655_1263 202
29 3300042593 Ga0466691_047050 Ga0466691_047050_3973_4581 202
30 3300042596 Ga0466696_006913 Ga0466696_006913_467_1075 202
31 3300042605 Ga0466716_143072 Ga0466716_143072_2530_3138 202
32 3300042606 Ga0466719_085927 Ga0466719_085927_31_639 202
33 3300042606 Ga0466719_558470 Ga0466719_558470_664_1272 202
34 3300042609 Ga0466722_118888 Ga0466722_118888_7714_8322 202
35 3300042612 Ga0466705_340330 Ga0466705_340330_1135_1743 202
36 3300042614 Ga0466712_039319 Ga0466712_039319_1429_2037 202
37 3300042616 Ga0466715_131105 Ga0466715_131105_2259_2867 202
38 3300042616 Ga0466715_278389 Ga0466715_278389_1387_1995 202
39 3300042616 Ga0466715_338445 Ga0466715_338445_15362_15970 202
40 3300042618 Ga0466723_139730 Ga0466723_139730_1180_1788 202
41 3300042643 Ga0466704_228684 Ga0466704_228684_5559_6167 202
42 3300042648 Ga0466709_068755 Ga0466709_068755_998_1606 202
43 3300042648 Ga0466709_331902 Ga0466709_331902_2062_2670 202
44 3300042652 Ga0466708_030492 Ga0466708_030492_3500_4108 202
45 3300042652 Ga0466708_066838 Ga0466708_066838_18092_18700 202
46 3300042652 Ga0466708_232686 Ga0466708_232686_1409_2017 202
47 3300042655 Ga0466727_048067 Ga0466727_048067_189_797 202
48 3300042655 Ga0466727_163476 Ga0466727_163476_3389_3997 202
49 iso_pr_bacteria 2781125692 2781431839 202
50 3300002449 JGI24698J34947_10039042 JGI24698J34947_100390422 203
51 3300002449 JGI24698J34947_10050093 JGI24698J34947_100500932 203
52 3300042595 Ga0466695_063524 Ga0466695_063524_4079_4690 203
53 3300042600 Ga0466700_325490 Ga0466700_325490_564_1175 203
54 3300042601 Ga0466707_206027 Ga0466707_206027_499_1110 203
55 3300042612 Ga0466705_218629 Ga0466705_218629_2741_3352 203
56 3300042616 Ga0466715_226275 Ga0466715_226275_7032_7643 203
57 3300042618 Ga0466723_038166 Ga0466723_038166_2124_2735 203
58 3300042621 Ga0466729_134193 Ga0466729_134193_507_1118 203
59 3300042622 Ga0466731_247662 Ga0466731_247662_872_1483 203
60 3300042643 Ga0466704_144518 Ga0466704_144518_7600_8211 203
61 iso_pr_bacteria 2781125691 2781429127 203
62 3300042605 Ga0466716_051618 Ga0466716_051618_3439_4053 204
63 3300042605 Ga0466716_370062 Ga0466716_370062_401_1015 204
64 3300042606 Ga0466719_125550 Ga0466719_125550_124_738 204
65 3300042606 Ga0466719_520969 Ga0466719_520969_1009_1623 204
66 3300042616 Ga0466715_312142 Ga0466715_312142_11656_12270 204
67 3300042616 Ga0466715_481844 Ga0466715_481844_4237_4851 204
68 3300042618 Ga0466723_017798 Ga0466723_017798_7433_8047 204
69 3300042618 Ga0466723_260693 Ga0466723_260693_2185_2799 204
70 3300042620 Ga0466728_191092 Ga0466728_191092_991_1605 204
71 3300042620 Ga0466728_258415 Ga0466728_258415_3929_4543 204
72 3300042624 Ga0466735_133048 Ga0466735_133048_1392_2006 204
73 3300042636 Ga0466703_035407 Ga0466703_035407_2532_3146 204
74 3300042636 Ga0466703_103947 Ga0466703_103947_195_809 204
75 3300042636 Ga0466703_116071 Ga0466703_116071_546_1160 204
76 3300042636 Ga0466703_239484 Ga0466703_239484_546_1160 204
77 3300042636 Ga0466703_286328 Ga0466703_286328_195_809 204
78 3300042636 Ga0466703_413370 Ga0466703_413370_5474_6088 204
79 3300042643 Ga0466704_107342 Ga0466704_107342_345_959 204
80 3300042643 Ga0466704_286001 Ga0466704_286001_5712_6326 204
81 3300042643 Ga0466704_302653 Ga0466704_302653_4469_5083 204
82 3300042648 Ga0466709_050417 Ga0466709_050417_1170_1784 204
83 3300042648 Ga0466709_159197 Ga0466709_159197_1215_1829 204
84 3300042648 Ga0466709_381365 Ga0466709_381365_19570_20184 204
85 3300042652 Ga0466708_025410 Ga0466708_025410_517_1131 204
86 3300042652 Ga0466708_343097 Ga0466708_343097_2054_2668 204
87 3300042590 Ga0466690_040742 Ga0466690_040742_1009_1626 205
88 3300042590 Ga0466690_078911 Ga0466690_078911_401_1018 205
89 3300042590 Ga0466690_389635 Ga0466690_389635_1359_1976 205
90 3300042601 Ga0466707_180530 Ga0466707_180530_167_784 205
91 3300042601 Ga0466707_382239 Ga0466707_382239_246_863 205
92 3300042606 Ga0466719_033519 Ga0466719_033519_474_1091 205
93 3300042619 Ga0466726_166077 Ga0466726_166077_211_828 205
94 3300042635 Ga0466702_126621 Ga0466702_126621_243_860 205
95 3300042643 Ga0466704_224322 Ga0466704_224322_171_788 205
96 3300042601 Ga0466707_199385 Ga0466707_199385_548_1168 206
97 3300042606 Ga0466719_352927 Ga0466719_352927_451_1071 206
98 3300042606 Ga0466719_375505 Ga0466719_375505_318_938 206
99 3300042606 Ga0466719_499064 Ga0466719_499064_462_1082 206
100 3300042612 Ga0466705_019389 Ga0466705_019389_3895_4515 206
101 3300042621 Ga0466729_199377 Ga0466729_199377_1459_2079 206
102 3300042624 Ga0466735_002079 Ga0466735_002079_707_1327 206
103 3300042624 Ga0466735_020895 Ga0466735_020895_191_811 206
104 3300042624 Ga0466735_037440 Ga0466735_037440_6607_7227 206
105 3300042624 Ga0466735_065722 Ga0466735_065722_1614_2234 206
106 3300042624 Ga0466735_122506 Ga0466735_122506_1746_2366 206
107 3300042652 Ga0466708_008318 Ga0466708_008318_1046_1666 206
108 iso_pr_bacteria 650716102 650883947 206
109 3300042616 Ga0466715_463170 Ga0466715_463170_4743_5366 207
110 3300042652 Ga0466708_002668 Ga0466708_002668_6609_7232 207
111 iso_pr_bacteria 650716099 650878172 208
112 3300010882 Ga0123354_10016977 Ga0123354_100169773 209
113 3300009784 Ga0123357_10014743 Ga0123357_100147432 210
114 3300042609 Ga0466722_090488 Ga0466722_090488_521_1153 210
115 3300042612 Ga0466705_083290 Ga0466705_083290_298_948 216
116 3300042612 Ga0466705_181501 Ga0466705_181501_937_1587 216
117 3300042593 Ga0466691_142615 Ga0466691_142615_630_1289 219
118 3300042618 Ga0466723_022565 Ga0466723_022565_2488_3189 233
119 3300042643 Ga0466704_484696 Ga0466704_484696_2616_3317 233
120 3300042596 Ga0466696_386021 Ga0466696_386021_8590_9360 256

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01726 LexA_DNA_bind LexA DNA binding domain 32 95 0.98
PF00717 Peptidase_S24 Peptidase S24-like 115 226 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.58 0.65 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.