Protein Family IF07995
Metagenome
Isolate
140
Members
50
Samples
134
Scaffolds
281.32
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_017969|Ga0466723_017969_3930_4748
- Length
- 272 aa
- Sequence
- MAHCISAEAEKILDKEFTVLDKGFVRLVDYLGSDERVVQSARVSYGEGTKSYREDAGLIDYLLRNRHTSPFEQVVLTFHVKMPIFVARQWVRHRTARLNEISGRYSVMKDDFYVPAAGDIALQSSDNKQGRGGTLPPDKAEAYRAAFEAGQRSSYGEYVKLIDSGLARELARINLPLSLYTEIYWQIDLHNLFHFLELRLGAHAQKEIRLYAQTLLDISRKVAPRCCESFERHVLGGAAFSKDEFEEIKRRLRGEGGILEGKSLERFEEKLK
Sample Types
Isolate
4.3%
Metagenome
95.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.7%
Kalotermitidae
28.6%
Unclassified
16.3%
Rhinotermitidae
8.2%
Termopsidae
6.1%
Hodotermitidae
2.0%
Blaberidae
2.0%
Taxonomy
Archaea
0
Bacteria
138
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 16 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 17 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 22 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 23 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 24 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 25 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 26 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 27 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 28 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 29 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 30 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 31 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 32 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 33 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 34 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 35 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 36 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 37 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 38 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 39 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 42 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 43 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 44 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 45 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466703_006326 | 3300042636 | Bacteria | 52440 |
| 2 | Ga0466727_200620 | 3300042655 | Bacteria | 7863 |
| 3 | Ga0466727_287546 | 3300042655 | Bacteria | 1138 |
| 4 | Ga0466712_003475 | 3300042614 | Bacteria | 8084 |
| 5 | Ga0466715_482924 | 3300042616 | Bacteria | 13726 |
| 6 | Ga0466718_006067 | 3300042617 | Bacteria | 1884 |
| 7 | Ga0466723_017969 | 3300042618 | Bacteria | 6039 |
| 8 | Ga0466692_159308 | 3300042591 | Bacteria | 1910 |
| 9 | Ga0466692_196378 | 3300042591 | Bacteria | 15491 |
| 10 | Ga0466695_166207 | 3300042595 | Bacteria | 7339 |
| 11 | Ga0466695_384246 | 3300042595 | Bacteria | 2423 |
| 12 | Ga0466719_082632 | 3300042606 | Bacteria | 2932 |
| 13 | JGI24698J34947_10082539 | 3300002449 | Bacteria | 1502 |
| 14 | JGI24705J35276_12105863 | 3300002504 | Bacteria | 1030 |
| 15 | Ga0466732_320496 | 3300042656 | Bacteria | 4234 |
| 16 | Ga0466733_116806 | 3300042659 | Bacteria | 2314 |
| 17 | Ga0466735_047991 | 3300042624 | Bacteria | 1692 |
| 18 | Ga0466735_065470 | 3300042624 | Bacteria | 10374 |
| 19 | Ga0466709_279366 | 3300042648 | Bacteria | 21672 |
| 20 | Ga0466712_306105 | 3300042614 | Bacteria | 3421 |
| 21 | Ga0123353_10013463 | 3300010167 | Bacteria | 11719 |
| 22 | Ga0466690_237279 | 3300042590 | Bacteria | 4031 |
| 23 | Ga0466691_168625 | 3300042593 | Bacteria | 2172 |
| 24 | Ga0466694_355056 | 3300042594 | Bacteria | 6044 |
| 25 | Ga0466706_209442 | 3300042599 | Bacteria | 1180 |
| 26 | Ga0466707_371121 | 3300042601 | Bacteria | 2467 |
| 27 | Ga0466707_406369 | 3300042601 | Bacteria | 3023 |
| 28 | Ga0466716_023442 | 3300042605 | Bacteria | 2575 |
| 29 | Ga0466719_143962 | 3300042606 | Bacteria | 15653 |
| 30 | Ga0466719_164425 | 3300042606 | Bacteria | 19303 |
| 31 | Ga0466720_055102 | 3300042607 | Bacteria | 1785 |
| 32 | AustNasuHG_c1003420 | 3300000089 | Bacteria | 5730 |
| 33 | JGI24698J34947_10001760 | 3300002449 | Bacteria | 11539 |
| 34 | JGI24698J34947_10022372 | 3300002449 | Bacteria | 3391 |
| 35 | JGI24698J34947_10085858 | 3300002449 | Bacteria | 1460 |
| 36 | Ga0466732_038876 | 3300042656 | Bacteria | 1114 |
| 37 | Ga0466704_424886 | 3300042643 | Bacteria | 5681 |
| 38 | Ga0466708_187416 | 3300042652 | Bacteria | 8401 |
| 39 | Ga0466708_247084 | 3300042652 | Bacteria | 1916 |
| 40 | Ga0466715_449185 | 3300042616 | Bacteria | 3526 |
| 41 | Ga0466715_604287 | 3300042616 | Bacteria | 3027 |
| 42 | Ga0466718_080631 | 3300042617 | Bacteria | 14057 |
| 43 | Ga0466726_429954 | 3300042619 | Bacteria | 2669 |
| 44 | Ga0466716_492575 | 3300042605 | Bacteria | 1797 |
| 45 | Ga0466719_028855 | 3300042606 | Bacteria | 31838 |
| 46 | Ga0466720_116227 | 3300042607 | Bacteria | 2950 |
| 47 | Ga0466735_050399 | 3300042624 | Bacteria | 5697 |
| 48 | Ga0466703_090897 | 3300042636 | Bacteria | 2098 |
| 49 | Ga0466703_250365 | 3300042636 | Bacteria | 16431 |
| 50 | Ga0466704_533517 | 3300042643 | Bacteria | 3544 |
| 51 | Ga0466709_226965 | 3300042648 | Bacteria | 29188 |
| 52 | Ga0466708_088365 | 3300042652 | Bacteria | 38009 |
| 53 | Ga0466708_305335 | 3300042652 | Bacteria | 5465 |
| 54 | Ga0466715_234891 | 3300042616 | Bacteria | 22388 |
| 55 | Ga0466715_521776 | 3300042616 | Bacteria | 5883 |
| 56 | Ga0466718_154841 | 3300042617 | Bacteria | 7121 |
| 57 | Ga0466723_038100 | 3300042618 | Bacteria | 3124 |
| 58 | Ga0466723_306173 | 3300042618 | Bacteria | 5613 |
| 59 | Ga0466723_369817 | 3300042618 | Unclassified | 2591 |
| 60 | Ga0466726_087688 | 3300042619 | Bacteria | 9578 |
| 61 | Ga0466726_105607 | 3300042619 | Bacteria | 4333 |
| 62 | Ga0466726_181654 | 3300042619 | Bacteria | 2404 |
| 63 | Ga0466690_084045 | 3300042590 | Bacteria | 1602 |
| 64 | Ga0466691_034517 | 3300042593 | Bacteria | 6710 |
| 65 | Ga0466691_089147 | 3300042593 | Bacteria | 5057 |
| 66 | Ga0466694_365653 | 3300042594 | Bacteria | 1967 |
| 67 | Ga0466696_045296 | 3300042596 | Bacteria | 2222 |
| 68 | Ga0466699_149459 | 3300042597 | Bacteria | 1127 |
| 69 | Ga0466722_069912 | 3300042609 | Bacteria | 9892 |
| 70 | Ga0466722_137656 | 3300042609 | Bacteria | 2646 |
| 71 | Ga0466698_248345 | 3300042610 | Bacteria | 1093 |
| 72 | JGI24696J40584_12954131 | 3300002834 | Bacteria | 2589 |
| 73 | Ga0072941_1003344 | 3300005201 | Bacteria | 65628 |
| 74 | Ga0466703_136548 | 3300042636 | Bacteria | 1789 |
| 75 | Ga0466727_216572 | 3300042655 | Bacteria | 1426 |
| 76 | Ga0466726_233690 | 3300042619 | Bacteria | 11568 |
| 77 | Ga0466726_488408 | 3300042619 | Bacteria | 2006 |
| 78 | Ga0123356_10205216 | 3300010049 | Bacteria | 2014 |
| 79 | Ga0456237_0000736 | 3300041968 | Bacteria | 5046 |
| 80 | Ga0466716_203203 | 3300042605 | Bacteria | 1217 |
| 81 | JGI24702J35022_10007773 | 3300002462 | Bacteria | 6117 |
| 82 | Ga0068305_10381907 | 3300005083 | Bacteria | 2262 |
| 83 | Ga0466709_112279 | 3300042648 | Bacteria | 2744 |
| 84 | Ga0466708_122619 | 3300042652 | Bacteria | 14870 |
| 85 | Ga0466727_136003 | 3300042655 | Bacteria | 5583 |
| 86 | Ga0466727_152068 | 3300042655 | Bacteria | 2276 |
| 87 | Ga0466715_163751 | 3300042616 | Bacteria | 7493 |
| 88 | Ga0466715_249803 | 3300042616 | Bacteria | 3204 |
| 89 | Ga0466718_064083 | 3300042617 | Bacteria | 8988 |
| 90 | Ga0466728_064699 | 3300042620 | Bacteria | 11987 |
| 91 | Ga0466728_355359 | 3300042620 | Bacteria | 4887 |
| 92 | Ga0123357_10006119 | 3300009784 | Bacteria | 14584 |
| 93 | Ga0466692_026828 | 3300042591 | Bacteria | 1677 |
| 94 | Ga0466692_116221 | 3300042591 | Bacteria | 12880 |
| 95 | Ga0466696_166894 | 3300042596 | Bacteria | 8416 |
| 96 | Ga0466699_115858 | 3300042597 | Bacteria | 1641 |
| 97 | JGI24698J34947_10003072 | 3300002449 | Bacteria | 9039 |
| 98 | Ga0466705_328272 | 3300042612 | Bacteria | 3777 |
| 99 | Ga0466712_105034 | 3300042614 | Bacteria | 39434 |
| 100 | Ga0466711_207277 | 3300042615 | Bacteria | 40469 |
| 101 | Ga0466715_147926 | 3300042616 | Bacteria | 4436 |
| 102 | Ga0466715_459856 | 3300042616 | Bacteria | 6064 |
| 103 | Ga0466718_013134 | 3300042617 | Bacteria | 11259 |
| 104 | Ga0466723_243195 | 3300042618 | Bacteria | 87629 |
| 105 | Ga0466723_282923 | 3300042618 | Bacteria | 4943 |
| 106 | Ga0123356_11072051 | 3300010049 | Bacteria | 975 |
| 107 | Ga0123353_10184061 | 3300010167 | Bacteria | 3304 |
| 108 | Ga0466692_164371 | 3300042591 | Bacteria | 1792 |
| 109 | Ga0466696_443993 | 3300042596 | Bacteria | 2704 |
| 110 | Ga0466707_068232 | 3300042601 | Bacteria | 1567 |
| 111 | Ga0466713_009090 | 3300042602 | Bacteria | 5957 |
| 112 | Ga0466719_264337 | 3300042606 | Bacteria | 4355 |
| 113 | AustNasuHG_c1000298 | 3300000089 | Bacteria | 17246 |
| 114 | JGI24698J34947_10000402 | 3300002449 | Bacteria | 19694 |
| 115 | JGI24698J34947_10002120 | 3300002449 | Bacteria | 10621 |
| 116 | JGI24698J34947_10130219 | 3300002449 | Bacteria | 1076 |
| 117 | Ga0466732_327589 | 3300042656 | Unclassified | 1010 |
| 118 | Ga0466732_440302 | 3300042656 | Bacteria | 3186 |
| 119 | Ga0466733_016235 | 3300042659 | Bacteria | 27341 |
| 120 | Ga0466729_292038 | 3300042621 | Bacteria | 1823 |
| 121 | Ga0466708_029606 | 3300042652 | Bacteria | 1725 |
| 122 | Ga0466712_056710 | 3300042614 | Bacteria | 20764 |
| 123 | Ga0466711_240105 | 3300042615 | Bacteria | 5455 |
| 124 | Ga0466726_420781 | 3300042619 | Bacteria | 2099 |
| 125 | Ga0466726_450702 | 3300042619 | Bacteria | 12973 |
| 126 | Ga0123357_10334216 | 3300009784 | Bacteria | 1475 |
| 127 | Ga0123353_10313240 | 3300010167 | Bacteria | 2386 |
| 128 | Ga0415639_018584 | 3300038395 | Bacteria | 4319 |
| 129 | Ga0466690_349356 | 3300042590 | Bacteria | 2679 |
| 130 | Ga0466692_089444 | 3300042591 | Bacteria | 3158 |
| 131 | Ga0466706_257494 | 3300042599 | Bacteria | 1231 |
| 132 | Ga0466722_052316 | 3300042609 | Bacteria | 16679 |
| 133 | JGI24698J34947_10112214 | 3300002449 | Bacteria | 1201 |
| 134 | JGI24702J35022_10018309 | 3300002462 | Bacteria | 3821 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042656 | Ga0466732_327589 | Ga0466732_327589_11_766 | 251 |
| 2 | 3300042590 | Ga0466690_349356 | Ga0466690_349356_1796_2560 | 254 |
| 3 | 3300042656 | Ga0466732_038876 | Ga0466732_038876_315_1088 | 257 |
| 4 | 3300042593 | Ga0466691_034517 | Ga0466691_034517_1692_2480 | 262 |
| 5 | 3300042656 | Ga0466732_440302 | Ga0466732_440302_419_1267 | 265 |
| 6 | 3300002449 | JGI24698J34947_10003072 | JGI24698J34947_100030721 | 268 |
| 7 | 3300042655 | Ga0466727_287546 | Ga0466727_287546_86_934 | 269 |
| 8 | 3300042618 | Ga0466723_369817 | Ga0466723_369817_381_1223 | 270 |
| 9 | 3300042616 | Ga0466715_604287 | Ga0466715_604287_1899_2714 | 271 |
| 10 | 3300042618 | Ga0466723_017969 | Ga0466723_017969_3930_4748 | 272 |
| 11 | 3300042636 | Ga0466703_136548 | Ga0466703_136548_339_1208 | 272 |
| 12 | 3300042605 | Ga0466716_023442 | Ga0466716_023442_534_1355 | 273 |
| 13 | 3300042618 | Ga0466723_282923 | Ga0466723_282923_799_1620 | 273 |
| 14 | 3300005083 | Ga0068305_10381907 | Ga0068305_103819074 | 274 |
| 15 | 3300042595 | Ga0466695_384246 | Ga0466695_384246_455_1279 | 274 |
| 16 | 3300042596 | Ga0466696_443993 | Ga0466696_443993_1618_2442 | 274 |
| 17 | 3300042601 | Ga0466707_068232 | Ga0466707_068232_410_1234 | 274 |
| 18 | 3300042597 | Ga0466699_115858 | Ga0466699_115858_290_1117 | 275 |
| 19 | 3300042599 | Ga0466706_257494 | Ga0466706_257494_284_1141 | 275 |
| 20 | 3300042619 | Ga0466726_087688 | Ga0466726_087688_564_1391 | 275 |
| 21 | 3300042624 | Ga0466735_047991 | Ga0466735_047991_809_1636 | 275 |
| 22 | 3300042624 | Ga0466735_065470 | Ga0466735_065470_7767_8594 | 275 |
| 23 | 3300009784 | Ga0123357_10334216 | Ga0123357_103342162 | 276 |
| 24 | 3300042593 | Ga0466691_168625 | Ga0466691_168625_166_996 | 276 |
| 25 | iso_pr_bacteria | 2781125632 | 2781271250 | 276 |
| 26 | 3300010049 | Ga0123356_10205216 | Ga0123356_102052161 | 277 |
| 27 | 3300042606 | Ga0466719_264337 | Ga0466719_264337_296_1129 | 277 |
| 28 | 3300042612 | Ga0466705_328272 | Ga0466705_328272_264_1097 | 277 |
| 29 | 3300042618 | Ga0466723_038100 | Ga0466723_038100_903_1736 | 277 |
| 30 | 3300042606 | Ga0466719_143962 | Ga0466719_143962_5657_6493 | 278 |
| 31 | 3300042619 | Ga0466726_233690 | Ga0466726_233690_4780_5616 | 278 |
| 32 | 3300042619 | Ga0466726_420781 | Ga0466726_420781_373_1209 | 278 |
| 33 | 3300042620 | Ga0466728_064699 | Ga0466728_064699_2867_3703 | 278 |
| 34 | 3300042643 | Ga0466704_533517 | Ga0466704_533517_1572_2408 | 278 |
| 35 | 3300010167 | Ga0123353_10013463 | Ga0123353_100134638 | 279 |
| 36 | 3300042605 | Ga0466716_203203 | Ga0466716_203203_163_1002 | 279 |
| 37 | 3300042619 | Ga0466726_105607 | Ga0466726_105607_828_1667 | 279 |
| 38 | iso_pr_bacteria | 2781125681 | 2781407605 | 279 |
| 39 | 3300041968 | Ga0456237_0000736 | Ga0456237_0000736_3253_4095 | 280 |
| 40 | 3300042590 | Ga0466690_237279 | Ga0466690_237279_2308_3150 | 280 |
| 41 | 3300042594 | Ga0466694_355056 | Ga0466694_355056_537_1379 | 280 |
| 42 | 3300042596 | Ga0466696_045296 | Ga0466696_045296_552_1394 | 280 |
| 43 | 3300042609 | Ga0466722_137656 | Ga0466722_137656_1271_2113 | 280 |
| 44 | 3300042615 | Ga0466711_240105 | Ga0466711_240105_3377_4219 | 280 |
| 45 | 3300042616 | Ga0466715_163751 | Ga0466715_163751_2684_3598 | 280 |
| 46 | 3300042616 | Ga0466715_521776 | Ga0466715_521776_1613_2455 | 280 |
| 47 | 3300042617 | Ga0466718_006067 | Ga0466718_006067_370_1212 | 280 |
| 48 | 3300042617 | Ga0466718_080631 | Ga0466718_080631_2753_3622 | 280 |
| 49 | 3300042618 | Ga0466723_306173 | Ga0466723_306173_2493_3335 | 280 |
| 50 | 3300042652 | Ga0466708_029606 | Ga0466708_029606_256_1098 | 280 |
| 51 | 3300042659 | Ga0466733_016235 | Ga0466733_016235_19959_20801 | 280 |
| 52 | 3300002834 | JGI24696J40584_12954131 | JGI24696J40584_129541312 | 281 |
| 53 | 3300042591 | Ga0466692_116221 | Ga0466692_116221_11111_11956 | 281 |
| 54 | 3300042591 | Ga0466692_196378 | Ga0466692_196378_8667_9512 | 281 |
| 55 | 3300042593 | Ga0466691_089147 | Ga0466691_089147_307_1152 | 281 |
| 56 | 3300042594 | Ga0466694_365653 | Ga0466694_365653_261_1106 | 281 |
| 57 | 3300042597 | Ga0466699_149459 | Ga0466699_149459_257_1102 | 281 |
| 58 | 3300042599 | Ga0466706_209442 | Ga0466706_209442_26_871 | 281 |
| 59 | 3300042601 | Ga0466707_406369 | Ga0466707_406369_196_1041 | 281 |
| 60 | 3300042606 | Ga0466719_164425 | Ga0466719_164425_12608_13453 | 281 |
| 61 | 3300042607 | Ga0466720_116227 | Ga0466720_116227_1976_2821 | 281 |
| 62 | 3300042614 | Ga0466712_003475 | Ga0466712_003475_3211_4056 | 281 |
| 63 | 3300042614 | Ga0466712_056710 | Ga0466712_056710_9929_10774 | 281 |
| 64 | 3300042614 | Ga0466712_105034 | Ga0466712_105034_16647_17492 | 281 |
| 65 | 3300042614 | Ga0466712_306105 | Ga0466712_306105_1521_2366 | 281 |
| 66 | 3300042619 | Ga0466726_450702 | Ga0466726_450702_8615_9460 | 281 |
| 67 | 3300042619 | Ga0466726_488408 | Ga0466726_488408_447_1292 | 281 |
| 68 | 3300042620 | Ga0466728_355359 | Ga0466728_355359_3331_4176 | 281 |
| 69 | 3300042624 | Ga0466735_050399 | Ga0466735_050399_1428_2273 | 281 |
| 70 | 3300042643 | Ga0466704_424886 | Ga0466704_424886_3613_4458 | 281 |
| 71 | 3300042652 | Ga0466708_305335 | Ga0466708_305335_581_1426 | 281 |
| 72 | 3300042656 | Ga0466732_320496 | Ga0466732_320496_1158_2003 | 281 |
| 73 | 3300002449 | JGI24698J34947_10001760 | JGI24698J34947_100017602 | 282 |
| 74 | 3300002449 | JGI24698J34947_10002120 | JGI24698J34947_100021207 | 282 |
| 75 | 3300002449 | JGI24698J34947_10022372 | JGI24698J34947_100223721 | 282 |
| 76 | 3300002449 | JGI24698J34947_10082539 | JGI24698J34947_100825391 | 282 |
| 77 | 3300002449 | JGI24698J34947_10085858 | JGI24698J34947_100858582 | 282 |
| 78 | 3300002449 | JGI24698J34947_10112214 | JGI24698J34947_101122141 | 282 |
| 79 | 3300002449 | JGI24698J34947_10130219 | JGI24698J34947_101302191 | 282 |
| 80 | 3300010167 | Ga0123353_10184061 | Ga0123353_101840612 | 282 |
| 81 | 3300038395 | Ga0415639_018584 | Ga0415639_018584_1720_2568 | 282 |
| 82 | 3300042602 | Ga0466713_009090 | Ga0466713_009090_289_1137 | 282 |
| 83 | 3300042636 | Ga0466703_006326 | Ga0466703_006326_26613_27461 | 282 |
| 84 | iso_pr_bacteria | 2781125629 | 2781264728 | 282 |
| 85 | 3300010167 | Ga0123353_10313240 | Ga0123353_103132402 | 283 |
| 86 | 3300042591 | Ga0466692_089444 | Ga0466692_089444_116_967 | 283 |
| 87 | 3300042606 | Ga0466719_028855 | Ga0466719_028855_27790_28641 | 283 |
| 88 | 3300042609 | Ga0466722_069912 | Ga0466722_069912_3913_4764 | 283 |
| 89 | 3300042610 | Ga0466698_248345 | Ga0466698_248345_125_976 | 283 |
| 90 | 3300042616 | Ga0466715_459856 | Ga0466715_459856_3552_4403 | 283 |
| 91 | 3300042617 | Ga0466718_064083 | Ga0466718_064083_57_908 | 283 |
| 92 | 3300042621 | Ga0466729_292038 | Ga0466729_292038_441_1292 | 283 |
| 93 | 3300042652 | Ga0466708_187416 | Ga0466708_187416_5190_6041 | 283 |
| 94 | 3300042652 | Ga0466708_247084 | Ga0466708_247084_359_1210 | 283 |
| 95 | 3300000089 | AustNasuHG_c1000298 | AustNasuHG_10002985 | 284 |
| 96 | 3300002462 | JGI24702J35022_10007773 | JGI24702J35022_100077734 | 284 |
| 97 | 3300002462 | JGI24702J35022_10018309 | JGI24702J35022_100183092 | 284 |
| 98 | 3300042615 | Ga0466711_207277 | Ga0466711_207277_13205_14059 | 284 |
| 99 | 3300042616 | Ga0466715_147926 | Ga0466715_147926_1666_2520 | 284 |
| 100 | 3300042617 | Ga0466718_013134 | Ga0466718_013134_1176_2030 | 284 |
| 101 | 3300042619 | Ga0466726_181654 | Ga0466726_181654_1061_1915 | 284 |
| 102 | 3300042636 | Ga0466703_090897 | Ga0466703_090897_74_928 | 284 |
| 103 | 3300042648 | Ga0466709_112279 | Ga0466709_112279_1628_2482 | 284 |
| 104 | 3300042659 | Ga0466733_116806 | Ga0466733_116806_673_1527 | 284 |
| 105 | iso_pr_bacteria | 2772190975 | 2773721434 | 284 |
| 106 | 3300000089 | AustNasuHG_c1003420 | AustNasuHG_10034203 | 285 |
| 107 | 3300042590 | Ga0466690_084045 | Ga0466690_084045_306_1163 | 285 |
| 108 | 3300042616 | Ga0466715_449185 | Ga0466715_449185_366_1223 | 285 |
| 109 | 3300042655 | Ga0466727_200620 | Ga0466727_200620_6602_7459 | 285 |
| 110 | iso_pr_bacteria | 2781125652 | 2781311068 | 285 |
| 111 | iso_pr_bacteria | 2781125691 | 2781428904 | 285 |
| 112 | 3300009784 | Ga0123357_10006119 | Ga0123357_100061198 | 286 |
| 113 | 3300042591 | Ga0466692_159308 | Ga0466692_159308_326_1186 | 286 |
| 114 | 3300042595 | Ga0466695_166207 | Ga0466695_166207_2159_3019 | 286 |
| 115 | 3300042616 | Ga0466715_482924 | Ga0466715_482924_10572_11432 | 286 |
| 116 | 3300002449 | JGI24698J34947_10000402 | JGI24698J34947_100004022 | 287 |
| 117 | 3300005201 | Ga0072941_1003344 | Ga0072941_100334452 | 287 |
| 118 | 3300042619 | Ga0466726_429954 | Ga0466726_429954_1131_1994 | 287 |
| 119 | 3300042655 | Ga0466727_216572 | Ga0466727_216572_527_1390 | 287 |
| 120 | 3300010049 | Ga0123356_11072051 | Ga0123356_110720511 | 288 |
| 121 | 3300042591 | Ga0466692_026828 | Ga0466692_026828_552_1418 | 288 |
| 122 | 3300042636 | Ga0466703_250365 | Ga0466703_250365_3723_4589 | 288 |
| 123 | 3300042652 | Ga0466708_088365 | Ga0466708_088365_495_1361 | 288 |
| 124 | 3300042655 | Ga0466727_152068 | Ga0466727_152068_385_1251 | 288 |
| 125 | 3300002504 | JGI24705J35276_12105863 | JGI24705J35276_121058631 | 289 |
| 126 | 3300042601 | Ga0466707_371121 | Ga0466707_371121_225_1094 | 289 |
| 127 | 3300042617 | Ga0466718_154841 | Ga0466718_154841_2502_3371 | 289 |
| 128 | 3300042648 | Ga0466709_226965 | Ga0466709_226965_25916_26785 | 289 |
| 129 | 3300042596 | Ga0466696_166894 | Ga0466696_166894_1224_2096 | 290 |
| 130 | 3300042606 | Ga0466719_082632 | Ga0466719_082632_979_1851 | 290 |
| 131 | 3300042618 | Ga0466723_243195 | Ga0466723_243195_29820_30692 | 290 |
| 132 | 3300042591 | Ga0466692_164371 | Ga0466692_164371_682_1557 | 291 |
| 133 | 3300042607 | Ga0466720_055102 | Ga0466720_055102_86_961 | 291 |
| 134 | 3300042648 | Ga0466709_279366 | Ga0466709_279366_474_1349 | 291 |
| 135 | 3300042605 | Ga0466716_492575 | Ga0466716_492575_337_1218 | 293 |
| 136 | 3300042609 | Ga0466722_052316 | Ga0466722_052316_7567_8460 | 297 |
| 137 | 3300042655 | Ga0466727_136003 | Ga0466727_136003_723_1616 | 297 |
| 138 | 3300042616 | Ga0466715_234891 | Ga0466715_234891_746_1642 | 298 |
| 139 | 3300042652 | Ga0466708_122619 | Ga0466708_122619_5611_6507 | 298 |
| 140 | 3300042616 | Ga0466715_249803 | Ga0466715_249803_218_1156 | 312 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02511 | Thy1 | Thymidylate synthase complementing protein | 26 | 224 | 0.9 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.86 | 0.86 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.