Protein Family IF07995

Metagenome Isolate
140 Members
50 Samples
134 Scaffolds
281.32 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_017969|Ga0466723_017969_3930_4748
Length
272 aa
Sequence
MAHCISAEAEKILDKEFTVLDKGFVRLVDYLGSDERVVQSARVSYGEGTKSYREDAGLIDYLLRNRHTSPFEQVVLTFHVKMPIFVARQWVRHRTARLNEISGRYSVMKDDFYVPAAGDIALQSSDNKQGRGGTLPPDKAEAYRAAFEAGQRSSYGEYVKLIDSGLARELARINLPLSLYTEIYWQIDLHNLFHFLELRLGAHAQKEIRLYAQTLLDISRKVAPRCCESFERHVLGGAAFSKDEFEEIKRRLRGEGGILEGKSLERFEEKLK

πŸ“Š Sample Types

Isolate 4.3%
Metagenome 95.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 36.7%
Kalotermitidae 28.6%
Unclassified 16.3%
Rhinotermitidae 8.2%
Termopsidae 6.1%
Hodotermitidae 2.0%
Blaberidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 138
Eukaryota 0
Viruses 0
Unclassified 2

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
2 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
12 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
13 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
16 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
17 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
18 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
19 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
20 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
21 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
22 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
23 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
24 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
25 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
26 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
27 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
28 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
29 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
30 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
31 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
32 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
33 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
34 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
35 2772190975 Treponema sp. RmG30 Isolate Blaberidae
36 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
37 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
38 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
39 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
40 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
41 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
42 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
43 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
44 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
45 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
46 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
47 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
48 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
49 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
50 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466703_006326 3300042636 Bacteria 52440
2 Ga0466727_200620 3300042655 Bacteria 7863
3 Ga0466727_287546 3300042655 Bacteria 1138
4 Ga0466712_003475 3300042614 Bacteria 8084
5 Ga0466715_482924 3300042616 Bacteria 13726
6 Ga0466718_006067 3300042617 Bacteria 1884
7 Ga0466723_017969 3300042618 Bacteria 6039
8 Ga0466692_159308 3300042591 Bacteria 1910
9 Ga0466692_196378 3300042591 Bacteria 15491
10 Ga0466695_166207 3300042595 Bacteria 7339
11 Ga0466695_384246 3300042595 Bacteria 2423
12 Ga0466719_082632 3300042606 Bacteria 2932
13 JGI24698J34947_10082539 3300002449 Bacteria 1502
14 JGI24705J35276_12105863 3300002504 Bacteria 1030
15 Ga0466732_320496 3300042656 Bacteria 4234
16 Ga0466733_116806 3300042659 Bacteria 2314
17 Ga0466735_047991 3300042624 Bacteria 1692
18 Ga0466735_065470 3300042624 Bacteria 10374
19 Ga0466709_279366 3300042648 Bacteria 21672
20 Ga0466712_306105 3300042614 Bacteria 3421
21 Ga0123353_10013463 3300010167 Bacteria 11719
22 Ga0466690_237279 3300042590 Bacteria 4031
23 Ga0466691_168625 3300042593 Bacteria 2172
24 Ga0466694_355056 3300042594 Bacteria 6044
25 Ga0466706_209442 3300042599 Bacteria 1180
26 Ga0466707_371121 3300042601 Bacteria 2467
27 Ga0466707_406369 3300042601 Bacteria 3023
28 Ga0466716_023442 3300042605 Bacteria 2575
29 Ga0466719_143962 3300042606 Bacteria 15653
30 Ga0466719_164425 3300042606 Bacteria 19303
31 Ga0466720_055102 3300042607 Bacteria 1785
32 AustNasuHG_c1003420 3300000089 Bacteria 5730
33 JGI24698J34947_10001760 3300002449 Bacteria 11539
34 JGI24698J34947_10022372 3300002449 Bacteria 3391
35 JGI24698J34947_10085858 3300002449 Bacteria 1460
36 Ga0466732_038876 3300042656 Bacteria 1114
37 Ga0466704_424886 3300042643 Bacteria 5681
38 Ga0466708_187416 3300042652 Bacteria 8401
39 Ga0466708_247084 3300042652 Bacteria 1916
40 Ga0466715_449185 3300042616 Bacteria 3526
41 Ga0466715_604287 3300042616 Bacteria 3027
42 Ga0466718_080631 3300042617 Bacteria 14057
43 Ga0466726_429954 3300042619 Bacteria 2669
44 Ga0466716_492575 3300042605 Bacteria 1797
45 Ga0466719_028855 3300042606 Bacteria 31838
46 Ga0466720_116227 3300042607 Bacteria 2950
47 Ga0466735_050399 3300042624 Bacteria 5697
48 Ga0466703_090897 3300042636 Bacteria 2098
49 Ga0466703_250365 3300042636 Bacteria 16431
50 Ga0466704_533517 3300042643 Bacteria 3544
51 Ga0466709_226965 3300042648 Bacteria 29188
52 Ga0466708_088365 3300042652 Bacteria 38009
53 Ga0466708_305335 3300042652 Bacteria 5465
54 Ga0466715_234891 3300042616 Bacteria 22388
55 Ga0466715_521776 3300042616 Bacteria 5883
56 Ga0466718_154841 3300042617 Bacteria 7121
57 Ga0466723_038100 3300042618 Bacteria 3124
58 Ga0466723_306173 3300042618 Bacteria 5613
59 Ga0466723_369817 3300042618 Unclassified 2591
60 Ga0466726_087688 3300042619 Bacteria 9578
61 Ga0466726_105607 3300042619 Bacteria 4333
62 Ga0466726_181654 3300042619 Bacteria 2404
63 Ga0466690_084045 3300042590 Bacteria 1602
64 Ga0466691_034517 3300042593 Bacteria 6710
65 Ga0466691_089147 3300042593 Bacteria 5057
66 Ga0466694_365653 3300042594 Bacteria 1967
67 Ga0466696_045296 3300042596 Bacteria 2222
68 Ga0466699_149459 3300042597 Bacteria 1127
69 Ga0466722_069912 3300042609 Bacteria 9892
70 Ga0466722_137656 3300042609 Bacteria 2646
71 Ga0466698_248345 3300042610 Bacteria 1093
72 JGI24696J40584_12954131 3300002834 Bacteria 2589
73 Ga0072941_1003344 3300005201 Bacteria 65628
74 Ga0466703_136548 3300042636 Bacteria 1789
75 Ga0466727_216572 3300042655 Bacteria 1426
76 Ga0466726_233690 3300042619 Bacteria 11568
77 Ga0466726_488408 3300042619 Bacteria 2006
78 Ga0123356_10205216 3300010049 Bacteria 2014
79 Ga0456237_0000736 3300041968 Bacteria 5046
80 Ga0466716_203203 3300042605 Bacteria 1217
81 JGI24702J35022_10007773 3300002462 Bacteria 6117
82 Ga0068305_10381907 3300005083 Bacteria 2262
83 Ga0466709_112279 3300042648 Bacteria 2744
84 Ga0466708_122619 3300042652 Bacteria 14870
85 Ga0466727_136003 3300042655 Bacteria 5583
86 Ga0466727_152068 3300042655 Bacteria 2276
87 Ga0466715_163751 3300042616 Bacteria 7493
88 Ga0466715_249803 3300042616 Bacteria 3204
89 Ga0466718_064083 3300042617 Bacteria 8988
90 Ga0466728_064699 3300042620 Bacteria 11987
91 Ga0466728_355359 3300042620 Bacteria 4887
92 Ga0123357_10006119 3300009784 Bacteria 14584
93 Ga0466692_026828 3300042591 Bacteria 1677
94 Ga0466692_116221 3300042591 Bacteria 12880
95 Ga0466696_166894 3300042596 Bacteria 8416
96 Ga0466699_115858 3300042597 Bacteria 1641
97 JGI24698J34947_10003072 3300002449 Bacteria 9039
98 Ga0466705_328272 3300042612 Bacteria 3777
99 Ga0466712_105034 3300042614 Bacteria 39434
100 Ga0466711_207277 3300042615 Bacteria 40469
101 Ga0466715_147926 3300042616 Bacteria 4436
102 Ga0466715_459856 3300042616 Bacteria 6064
103 Ga0466718_013134 3300042617 Bacteria 11259
104 Ga0466723_243195 3300042618 Bacteria 87629
105 Ga0466723_282923 3300042618 Bacteria 4943
106 Ga0123356_11072051 3300010049 Bacteria 975
107 Ga0123353_10184061 3300010167 Bacteria 3304
108 Ga0466692_164371 3300042591 Bacteria 1792
109 Ga0466696_443993 3300042596 Bacteria 2704
110 Ga0466707_068232 3300042601 Bacteria 1567
111 Ga0466713_009090 3300042602 Bacteria 5957
112 Ga0466719_264337 3300042606 Bacteria 4355
113 AustNasuHG_c1000298 3300000089 Bacteria 17246
114 JGI24698J34947_10000402 3300002449 Bacteria 19694
115 JGI24698J34947_10002120 3300002449 Bacteria 10621
116 JGI24698J34947_10130219 3300002449 Bacteria 1076
117 Ga0466732_327589 3300042656 Unclassified 1010
118 Ga0466732_440302 3300042656 Bacteria 3186
119 Ga0466733_016235 3300042659 Bacteria 27341
120 Ga0466729_292038 3300042621 Bacteria 1823
121 Ga0466708_029606 3300042652 Bacteria 1725
122 Ga0466712_056710 3300042614 Bacteria 20764
123 Ga0466711_240105 3300042615 Bacteria 5455
124 Ga0466726_420781 3300042619 Bacteria 2099
125 Ga0466726_450702 3300042619 Bacteria 12973
126 Ga0123357_10334216 3300009784 Bacteria 1475
127 Ga0123353_10313240 3300010167 Bacteria 2386
128 Ga0415639_018584 3300038395 Bacteria 4319
129 Ga0466690_349356 3300042590 Bacteria 2679
130 Ga0466692_089444 3300042591 Bacteria 3158
131 Ga0466706_257494 3300042599 Bacteria 1231
132 Ga0466722_052316 3300042609 Bacteria 16679
133 JGI24698J34947_10112214 3300002449 Bacteria 1201
134 JGI24702J35022_10018309 3300002462 Bacteria 3821

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042656 Ga0466732_327589 Ga0466732_327589_11_766 251
2 3300042590 Ga0466690_349356 Ga0466690_349356_1796_2560 254
3 3300042656 Ga0466732_038876 Ga0466732_038876_315_1088 257
4 3300042593 Ga0466691_034517 Ga0466691_034517_1692_2480 262
5 3300042656 Ga0466732_440302 Ga0466732_440302_419_1267 265
6 3300002449 JGI24698J34947_10003072 JGI24698J34947_100030721 268
7 3300042655 Ga0466727_287546 Ga0466727_287546_86_934 269
8 3300042618 Ga0466723_369817 Ga0466723_369817_381_1223 270
9 3300042616 Ga0466715_604287 Ga0466715_604287_1899_2714 271
10 3300042618 Ga0466723_017969 Ga0466723_017969_3930_4748 272
11 3300042636 Ga0466703_136548 Ga0466703_136548_339_1208 272
12 3300042605 Ga0466716_023442 Ga0466716_023442_534_1355 273
13 3300042618 Ga0466723_282923 Ga0466723_282923_799_1620 273
14 3300005083 Ga0068305_10381907 Ga0068305_103819074 274
15 3300042595 Ga0466695_384246 Ga0466695_384246_455_1279 274
16 3300042596 Ga0466696_443993 Ga0466696_443993_1618_2442 274
17 3300042601 Ga0466707_068232 Ga0466707_068232_410_1234 274
18 3300042597 Ga0466699_115858 Ga0466699_115858_290_1117 275
19 3300042599 Ga0466706_257494 Ga0466706_257494_284_1141 275
20 3300042619 Ga0466726_087688 Ga0466726_087688_564_1391 275
21 3300042624 Ga0466735_047991 Ga0466735_047991_809_1636 275
22 3300042624 Ga0466735_065470 Ga0466735_065470_7767_8594 275
23 3300009784 Ga0123357_10334216 Ga0123357_103342162 276
24 3300042593 Ga0466691_168625 Ga0466691_168625_166_996 276
25 iso_pr_bacteria 2781125632 2781271250 276
26 3300010049 Ga0123356_10205216 Ga0123356_102052161 277
27 3300042606 Ga0466719_264337 Ga0466719_264337_296_1129 277
28 3300042612 Ga0466705_328272 Ga0466705_328272_264_1097 277
29 3300042618 Ga0466723_038100 Ga0466723_038100_903_1736 277
30 3300042606 Ga0466719_143962 Ga0466719_143962_5657_6493 278
31 3300042619 Ga0466726_233690 Ga0466726_233690_4780_5616 278
32 3300042619 Ga0466726_420781 Ga0466726_420781_373_1209 278
33 3300042620 Ga0466728_064699 Ga0466728_064699_2867_3703 278
34 3300042643 Ga0466704_533517 Ga0466704_533517_1572_2408 278
35 3300010167 Ga0123353_10013463 Ga0123353_100134638 279
36 3300042605 Ga0466716_203203 Ga0466716_203203_163_1002 279
37 3300042619 Ga0466726_105607 Ga0466726_105607_828_1667 279
38 iso_pr_bacteria 2781125681 2781407605 279
39 3300041968 Ga0456237_0000736 Ga0456237_0000736_3253_4095 280
40 3300042590 Ga0466690_237279 Ga0466690_237279_2308_3150 280
41 3300042594 Ga0466694_355056 Ga0466694_355056_537_1379 280
42 3300042596 Ga0466696_045296 Ga0466696_045296_552_1394 280
43 3300042609 Ga0466722_137656 Ga0466722_137656_1271_2113 280
44 3300042615 Ga0466711_240105 Ga0466711_240105_3377_4219 280
45 3300042616 Ga0466715_163751 Ga0466715_163751_2684_3598 280
46 3300042616 Ga0466715_521776 Ga0466715_521776_1613_2455 280
47 3300042617 Ga0466718_006067 Ga0466718_006067_370_1212 280
48 3300042617 Ga0466718_080631 Ga0466718_080631_2753_3622 280
49 3300042618 Ga0466723_306173 Ga0466723_306173_2493_3335 280
50 3300042652 Ga0466708_029606 Ga0466708_029606_256_1098 280
51 3300042659 Ga0466733_016235 Ga0466733_016235_19959_20801 280
52 3300002834 JGI24696J40584_12954131 JGI24696J40584_129541312 281
53 3300042591 Ga0466692_116221 Ga0466692_116221_11111_11956 281
54 3300042591 Ga0466692_196378 Ga0466692_196378_8667_9512 281
55 3300042593 Ga0466691_089147 Ga0466691_089147_307_1152 281
56 3300042594 Ga0466694_365653 Ga0466694_365653_261_1106 281
57 3300042597 Ga0466699_149459 Ga0466699_149459_257_1102 281
58 3300042599 Ga0466706_209442 Ga0466706_209442_26_871 281
59 3300042601 Ga0466707_406369 Ga0466707_406369_196_1041 281
60 3300042606 Ga0466719_164425 Ga0466719_164425_12608_13453 281
61 3300042607 Ga0466720_116227 Ga0466720_116227_1976_2821 281
62 3300042614 Ga0466712_003475 Ga0466712_003475_3211_4056 281
63 3300042614 Ga0466712_056710 Ga0466712_056710_9929_10774 281
64 3300042614 Ga0466712_105034 Ga0466712_105034_16647_17492 281
65 3300042614 Ga0466712_306105 Ga0466712_306105_1521_2366 281
66 3300042619 Ga0466726_450702 Ga0466726_450702_8615_9460 281
67 3300042619 Ga0466726_488408 Ga0466726_488408_447_1292 281
68 3300042620 Ga0466728_355359 Ga0466728_355359_3331_4176 281
69 3300042624 Ga0466735_050399 Ga0466735_050399_1428_2273 281
70 3300042643 Ga0466704_424886 Ga0466704_424886_3613_4458 281
71 3300042652 Ga0466708_305335 Ga0466708_305335_581_1426 281
72 3300042656 Ga0466732_320496 Ga0466732_320496_1158_2003 281
73 3300002449 JGI24698J34947_10001760 JGI24698J34947_100017602 282
74 3300002449 JGI24698J34947_10002120 JGI24698J34947_100021207 282
75 3300002449 JGI24698J34947_10022372 JGI24698J34947_100223721 282
76 3300002449 JGI24698J34947_10082539 JGI24698J34947_100825391 282
77 3300002449 JGI24698J34947_10085858 JGI24698J34947_100858582 282
78 3300002449 JGI24698J34947_10112214 JGI24698J34947_101122141 282
79 3300002449 JGI24698J34947_10130219 JGI24698J34947_101302191 282
80 3300010167 Ga0123353_10184061 Ga0123353_101840612 282
81 3300038395 Ga0415639_018584 Ga0415639_018584_1720_2568 282
82 3300042602 Ga0466713_009090 Ga0466713_009090_289_1137 282
83 3300042636 Ga0466703_006326 Ga0466703_006326_26613_27461 282
84 iso_pr_bacteria 2781125629 2781264728 282
85 3300010167 Ga0123353_10313240 Ga0123353_103132402 283
86 3300042591 Ga0466692_089444 Ga0466692_089444_116_967 283
87 3300042606 Ga0466719_028855 Ga0466719_028855_27790_28641 283
88 3300042609 Ga0466722_069912 Ga0466722_069912_3913_4764 283
89 3300042610 Ga0466698_248345 Ga0466698_248345_125_976 283
90 3300042616 Ga0466715_459856 Ga0466715_459856_3552_4403 283
91 3300042617 Ga0466718_064083 Ga0466718_064083_57_908 283
92 3300042621 Ga0466729_292038 Ga0466729_292038_441_1292 283
93 3300042652 Ga0466708_187416 Ga0466708_187416_5190_6041 283
94 3300042652 Ga0466708_247084 Ga0466708_247084_359_1210 283
95 3300000089 AustNasuHG_c1000298 AustNasuHG_10002985 284
96 3300002462 JGI24702J35022_10007773 JGI24702J35022_100077734 284
97 3300002462 JGI24702J35022_10018309 JGI24702J35022_100183092 284
98 3300042615 Ga0466711_207277 Ga0466711_207277_13205_14059 284
99 3300042616 Ga0466715_147926 Ga0466715_147926_1666_2520 284
100 3300042617 Ga0466718_013134 Ga0466718_013134_1176_2030 284
101 3300042619 Ga0466726_181654 Ga0466726_181654_1061_1915 284
102 3300042636 Ga0466703_090897 Ga0466703_090897_74_928 284
103 3300042648 Ga0466709_112279 Ga0466709_112279_1628_2482 284
104 3300042659 Ga0466733_116806 Ga0466733_116806_673_1527 284
105 iso_pr_bacteria 2772190975 2773721434 284
106 3300000089 AustNasuHG_c1003420 AustNasuHG_10034203 285
107 3300042590 Ga0466690_084045 Ga0466690_084045_306_1163 285
108 3300042616 Ga0466715_449185 Ga0466715_449185_366_1223 285
109 3300042655 Ga0466727_200620 Ga0466727_200620_6602_7459 285
110 iso_pr_bacteria 2781125652 2781311068 285
111 iso_pr_bacteria 2781125691 2781428904 285
112 3300009784 Ga0123357_10006119 Ga0123357_100061198 286
113 3300042591 Ga0466692_159308 Ga0466692_159308_326_1186 286
114 3300042595 Ga0466695_166207 Ga0466695_166207_2159_3019 286
115 3300042616 Ga0466715_482924 Ga0466715_482924_10572_11432 286
116 3300002449 JGI24698J34947_10000402 JGI24698J34947_100004022 287
117 3300005201 Ga0072941_1003344 Ga0072941_100334452 287
118 3300042619 Ga0466726_429954 Ga0466726_429954_1131_1994 287
119 3300042655 Ga0466727_216572 Ga0466727_216572_527_1390 287
120 3300010049 Ga0123356_11072051 Ga0123356_110720511 288
121 3300042591 Ga0466692_026828 Ga0466692_026828_552_1418 288
122 3300042636 Ga0466703_250365 Ga0466703_250365_3723_4589 288
123 3300042652 Ga0466708_088365 Ga0466708_088365_495_1361 288
124 3300042655 Ga0466727_152068 Ga0466727_152068_385_1251 288
125 3300002504 JGI24705J35276_12105863 JGI24705J35276_121058631 289
126 3300042601 Ga0466707_371121 Ga0466707_371121_225_1094 289
127 3300042617 Ga0466718_154841 Ga0466718_154841_2502_3371 289
128 3300042648 Ga0466709_226965 Ga0466709_226965_25916_26785 289
129 3300042596 Ga0466696_166894 Ga0466696_166894_1224_2096 290
130 3300042606 Ga0466719_082632 Ga0466719_082632_979_1851 290
131 3300042618 Ga0466723_243195 Ga0466723_243195_29820_30692 290
132 3300042591 Ga0466692_164371 Ga0466692_164371_682_1557 291
133 3300042607 Ga0466720_055102 Ga0466720_055102_86_961 291
134 3300042648 Ga0466709_279366 Ga0466709_279366_474_1349 291
135 3300042605 Ga0466716_492575 Ga0466716_492575_337_1218 293
136 3300042609 Ga0466722_052316 Ga0466722_052316_7567_8460 297
137 3300042655 Ga0466727_136003 Ga0466727_136003_723_1616 297
138 3300042616 Ga0466715_234891 Ga0466715_234891_746_1642 298
139 3300042652 Ga0466708_122619 Ga0466708_122619_5611_6507 298
140 3300042616 Ga0466715_249803 Ga0466715_249803_218_1156 312

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02511 Thy1 Thymidylate synthase complementing protein 26 224 0.9

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.