Protein Family IF07979

Metagenome Isolate
195 Members
63 Samples
174 Scaffolds
477.78 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_006640|Ga0466723_006640_3046_4707
Length
553 aa
Sequence
LYPAHICFFLSLFENAKIHEISQIAHGRIKNVFTKFIEEIYNKKIFETAKNETIKIIYIKDRMKKNLYFCKKLKQNIKAMQKHYFLAFDLGATSGRSILGTLEGDDFEIRELTRFPNTILELHGKYYWDIFGLYKSLKEGLTECAKQGIKLTSTGIDTWGVDFGYTGKDGAILGLPRAYRDPYTAGVSEAFFKIVPREKVYGKTGIQIMDFNSLYQLFAAKNENFSPLNAAEKILFMPDLLSYMLTGKQVCEYTGASTSQILNPETRRFETSLLEAAGIKPSILNTLIDPGTVVGTLTDLLAEETGIGKVPVVAVAGHDTASAVLAVPADNPNFAYLSSGTWSLMGVETEKPVLTKDSFEKNFTNEGGIEGTTRFLKNITGMWLLEQCRKEWEKEGRKYSYAEIVKMAESVAYYKCYINPDDPRLANPASMSKMIASICVENGSQPPATDAEYVRCIFESLVHRYKEVIDMLSEIISFPIEKLHIIGGGSQNELINQMTANQLGIPVIAGPSEATAIGNCMMQAKAAGLVKDRWEIRKIIAKAFAVKTFLPEE

📊 Sample Types

Isolate 10.8%
Metagenome 89.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 24.2%
Blattidae 22.6%
Kalotermitidae 22.6%
Unclassified 11.3%
Rhinotermitidae 6.5%
Termopsidae 4.8%
Hydrophilidae 3.2%
Passalidae 3.2%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 190
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
2 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
3 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
4 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
5 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
11 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
12 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
15 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
16 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
17 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
18 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
19 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
20 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
21 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
22 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
23 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
24 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
25 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
26 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
27 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
28 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
29 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
30 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
31 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
32 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
33 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
34 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
40 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
41 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
42 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
43 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
44 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
45 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
46 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
47 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
48 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
49 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
50 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
51 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
52 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
53 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
54 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
55 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
56 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
57 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
58 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
59 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
60 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
61 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
62 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
63 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_100268 3300042612 Bacteria 14782
2 Ga0466705_271246 3300042612 Bacteria 6889
3 Ga0123354_10004445 3300010882 Bacteria 19882
4 Ga0123354_10101598 3300010882 Bacteria 3882
5 Ga0466706_014807 3300042599 Bacteria 31983
6 Ga0466707_204250 3300042601 Bacteria 25895
7 Ga0466713_110857 3300042602 Bacteria 24993
8 Ga0466717_298133 3300042604 Bacteria 1488
9 Ga0466690_423985 3300042590 Bacteria 2879
10 Ga0466691_105872 3300042593 Bacteria 11905
11 Ga0466711_114294 3300042615 Bacteria 16823
12 Ga0466728_357481 3300042620 Bacteria 21016
13 Ga0466729_168096 3300042621 Bacteria 5802
14 Ga0466703_083838 3300042636 Bacteria 1897
15 Ga0466704_086836 3300042643 Bacteria 9438
16 Ga0466708_034593 3300042652 Bacteria 17359
17 2227594072 2225789004 Bacteria 12803
18 Ga0466733_098937 3300042659 Bacteria 150442
19 Ga0123354_10038965 3300010882 Bacteria 7371
20 Ga0466706_141606 3300042599 Bacteria 1990
21 Ga0466713_048578 3300042602 Unclassified 2268
22 Ga0466713_113316 3300042602 Bacteria 40093
23 Ga0466714_059757 3300042603 Bacteria 59062
24 Ga0466716_167878 3300042605 Bacteria 9694
25 Ga0466719_270811 3300042606 Bacteria 9663
26 Ga0466722_021369 3300042609 Bacteria 3340
27 Ga0466690_040127 3300042590 Bacteria 2365
28 Ga0466692_046708 3300042591 Bacteria 150257
29 Ga0466691_015140 3300042593 Bacteria 3629
30 Ga0466696_124171 3300042596 Bacteria 8996
31 Ga0466696_227581 3300042596 Bacteria 20008
32 Ga0466699_370256 3300042597 Bacteria 2749
33 Ga0466723_006640 3300042618 Bacteria 26078
34 Ga0466723_333646 3300042618 Bacteria 9814
35 Ga0466735_234793 3300042624 Bacteria 3571
36 Ga0466704_068446 3300042643 Bacteria 36408
37 Ga0466704_175652 3300042643 Bacteria 7752
38 Ga0466709_072784 3300042648 Bacteria 4185
39 Ga0466727_227555 3300042655 Bacteria 10119
40 JGI24702J35022_10002397 3300002462 Bacteria 11464
41 JGI24705J35276_12237825 3300002504 Bacteria 13403
42 JGI24696J40584_12955541 3300002834 Bacteria 2862
43 Ga0466705_120457 3300042612 Unclassified 3285
44 Ga0466733_025776 3300042659 Bacteria 86348
45 Ga0123356_10183353 3300010049 Bacteria 2117
46 Ga0466706_133122 3300042599 Bacteria 38436
47 Ga0466713_032013 3300042602 Bacteria 64924
48 Ga0466719_488972 3300042606 Bacteria 2335
49 Ga0466722_023454 3300042609 Bacteria 8074
50 Ga0466722_265821 3300042609 Bacteria 7666
51 Ga0466693_056569 3300042592 Bacteria 3799
52 Ga0466696_345561 3300042596 Bacteria 8211
53 Ga0466711_399830 3300042615 Bacteria 8252
54 Ga0466723_032717 3300042618 Bacteria 15968
55 Ga0466729_190457 3300042621 Bacteria 2678
56 Ga0466731_315388 3300042622 Bacteria 1956
57 Ga0466704_204223 3300042643 Bacteria 16498
58 Ga0466708_168646 3300042652 Bacteria 3715
59 Ga0466727_130463 3300042655 Bacteria 6939
60 Ga0466727_225007 3300042655 Bacteria 2686
61 IMNBL1DRAFT_c0003022 3300000062 Bacteria 11133
62 Ga0068305_10027801 3300005083 Bacteria 13859
63 Ga0072941_1240440 3300005201 Bacteria 2396
64 Ga0466733_099812 3300042659 Bacteria 20124
65 Ga0466707_135525 3300042601 Bacteria 5929
66 Ga0466713_138099 3300042602 Bacteria 10720
67 Ga0466719_315557 3300042606 Bacteria 3811
68 Ga0466696_115451 3300042596 Bacteria 1964
69 Ga0466711_007932 3300042615 Bacteria 16347
70 Ga0466715_621077 3300042616 Bacteria 7278
71 Ga0466723_110799 3300042618 Bacteria 7128
72 Ga0466735_217199 3300042624 Bacteria 2076
73 Ga0466703_037252 3300042636 Bacteria 4334
74 Ga0466703_057079 3300042636 Bacteria 4806
75 Ga0466704_063074 3300042643 Bacteria 10856
76 Ga0466704_320799 3300042643 Bacteria 3242
77 Ga0466704_610574 3300042643 Bacteria 4604
78 Ga0466727_196576 3300042655 Bacteria 91619
79 2227122483 2225789004 Bacteria 9127
80 IMNBL1DRAFT_c0003965 3300000062 Bacteria 9145
81 Ga0068302_10127312 3300005071 Bacteria 4210
82 Ga0466700_018200 3300042600 Bacteria 8348
83 Ga0466713_027482 3300042602 Bacteria 12651
84 Ga0466717_225618 3300042604 Bacteria 1833
85 Ga0466719_536246 3300042606 Bacteria 2596
86 Ga0466690_292384 3300042590 Bacteria 9195
87 Ga0466691_051621 3300042593 Bacteria 8516
88 Ga0466691_113066 3300042593 Bacteria 9717
89 Ga0466696_237105 3300042596 Bacteria 19903
90 Ga0466723_033742 3300042618 Bacteria 108590
91 Ga0466728_060762 3300042620 Bacteria 5497
92 Ga0466729_288296 3300042621 Bacteria 2105
93 Ga0466729_302522 3300042621 Unclassified 8052
94 Ga0466703_242236 3300042636 Bacteria 5200
95 Ga0068305_10178469 3300005083 Unclassified 1882
96 Ga0466733_015565 3300042659 Bacteria 17314
97 Ga0123356_10087362 3300010049 Bacteria 2962
98 Ga0466716_431653 3300042605 Bacteria 14412
99 Ga0466719_240642 3300042606 Bacteria 11381
100 Ga0466722_007565 3300042609 Bacteria 18233
101 Ga0466722_086939 3300042609 Bacteria 1681
102 Ga0466690_104588 3300042590 Bacteria 10613
103 Ga0466690_396645 3300042590 Bacteria 17447
104 Ga0466690_433741 3300042590 Bacteria 5853
105 Ga0466691_205213 3300042593 Bacteria 17897
106 Ga0466696_051573 3300042596 Bacteria 10685
107 Ga0466696_057705 3300042596 Bacteria 4885
108 Ga0466711_045786 3300042615 Bacteria 34187
109 Ga0466711_161039 3300042615 Bacteria 6317
110 Ga0466723_277956 3300042618 Bacteria 20013
111 Ga0466728_299084 3300042620 Bacteria 35234
112 Ga0466703_301439 3300042636 Bacteria 12285
113 Ga0466704_018563 3300042643 Bacteria 12561
114 Ga0466704_127151 3300042643 Bacteria 2229
115 Ga0466704_289330 3300042643 Bacteria 13732
116 Ga0466708_090904 3300042652 Bacteria 64814
117 Ga0466727_219070 3300042655 Bacteria 17923
118 Ga0466727_238916 3300042655 Bacteria 16389
119 2227631843 2225789004 Unclassified 2118
120 JGI24702J35022_10017917 3300002462 Bacteria 3866
121 Ga0068305_10320943 3300005083 Bacteria 6317
122 Ga0466705_133193 3300042612 Bacteria 13722
123 Ga0123353_10003561 3300010167 Bacteria 19724
124 Ga0466707_250647 3300042601 Bacteria 6673
125 Ga0466713_045837 3300042602 Bacteria 6488
126 Ga0466714_170196 3300042603 Bacteria 2328
127 Ga0466722_096172 3300042609 Bacteria 28272
128 Ga0466722_146298 3300042609 Bacteria 22965
129 Ga0466690_023696 3300042590 Bacteria 23811
130 Ga0466691_017241 3300042593 Bacteria 7213
131 Ga0466696_079205 3300042596 Bacteria 2810
132 Ga0466711_099584 3300042615 Bacteria 34400
133 Ga0466711_207352 3300042615 Bacteria 3649
134 Ga0466711_325608 3300042615 Bacteria 13781
135 Ga0466711_413937 3300042615 Bacteria 7952
136 Ga0466715_459244 3300042616 Bacteria 40519
137 Ga0466728_088604 3300042620 Bacteria 32489
138 Ga0466735_186780 3300042624 Bacteria 3950
139 Ga0466703_015658 3300042636 Bacteria 18950
140 Ga0466703_037385 3300042636 Bacteria 5044
141 Ga0466704_128682 3300042643 Bacteria 12645
142 Ga0466709_062466 3300042648 Bacteria 7409
143 Ga0466725_365748 3300042654 Bacteria 104297
144 Ga0466727_147874 3300042655 Bacteria 3357
145 Ga0466727_234492 3300042655 Bacteria 5477
146 Ga0072941_1322877 3300005201 Bacteria 5525
147 Ga0466705_102543 3300042612 Bacteria 3426
148 Ga0466705_158665 3300042612 Bacteria 18276
149 Ga0466706_156991 3300042599 Bacteria 68580
150 Ga0466707_391793 3300042601 Bacteria 4513
151 Ga0466713_129978 3300042602 Bacteria 70140
152 Ga0466716_139295 3300042605 Bacteria 15413
153 Ga0466716_165629 3300042605 Bacteria 14714
154 Ga0466719_165306 3300042606 Bacteria 5365
155 Ga0466719_231747 3300042606 Bacteria 5875
156 Ga0466722_210324 3300042609 Bacteria 22548
157 Ga0466656_352580 3300042550 Bacteria 10661
158 Ga0466690_034154 3300042590 Bacteria 3939
159 Ga0466692_183492 3300042591 Bacteria 12787
160 Ga0466691_063953 3300042593 Bacteria 3502
161 Ga0466696_204542 3300042596 Bacteria 4996
162 Ga0466696_312466 3300042596 Bacteria 5276
163 Ga0466696_463796 3300042596 Bacteria 19807
164 Ga0466715_017045 3300042616 Bacteria 22826
165 Ga0466715_509459 3300042616 Bacteria 8884
166 Ga0466723_064514 3300042618 Bacteria 6509
167 Ga0466735_103197 3300042624 Bacteria 1457
168 Ga0466703_039989 3300042636 Bacteria 3622
169 Ga0466703_411361 3300042636 Bacteria 13545
170 Ga0466709_013081 3300042648 Bacteria 23336
171 Ga0466725_094720 3300042654 Bacteria 12438
172 Ga0466727_083853 3300042655 Bacteria 7768
173 JGI24702J35022_10005414 3300002462 Bacteria 7470
174 Ga0068302_10018419 3300005071 Bacteria 3123

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042615 Ga0466711_099584 Ga0466711_099584_16215_17549 444
2 3300042615 Ga0466711_161039 Ga0466711_161039_1593_2927 444
3 3300005201 Ga0072941_1322877 Ga0072941_13228771 447
4 3300042606 Ga0466719_488972 Ga0466719_488972_356_1780 447
5 3300042636 Ga0466703_083838 Ga0466703_083838_355_1785 450
6 3300042606 Ga0466719_270811 Ga0466719_270811_6548_8014 453
7 3300042606 Ga0466719_536246 Ga0466719_536246_795_2219 455
8 3300042655 Ga0466727_219070 Ga0466727_219070_15805_17208 455
9 3300042590 Ga0466690_292384 Ga0466690_292384_1502_2977 456
10 3300042593 Ga0466691_015140 Ga0466691_015140_84_1559 456
11 3300042615 Ga0466711_045786 Ga0466711_045786_23309_24733 456
12 3300042618 Ga0466723_064514 Ga0466723_064514_3643_5118 456
13 3300002462 JGI24702J35022_10017917 JGI24702J35022_100179173 457
14 3300042606 Ga0466719_315557 Ga0466719_315557_1471_2946 457
15 3300042615 Ga0466711_207352 Ga0466711_207352_112_1587 457
16 3300042618 Ga0466723_032717 Ga0466723_032717_7675_9150 457
17 3300042618 Ga0466723_110799 Ga0466723_110799_5623_7098 457
18 3300010882 Ga0123354_10101598 Ga0123354_101015983 458
19 3300042600 Ga0466700_018200 Ga0466700_018200_442_1905 458
20 3300042605 Ga0466716_167878 Ga0466716_167878_5219_6595 458
21 3300042596 Ga0466696_312466 Ga0466696_312466_1606_3039 459
22 3300042620 Ga0466728_060762 Ga0466728_060762_3538_5013 459
23 3300042620 Ga0466728_299084 Ga0466728_299084_9651_11129 459
24 3300005071 Ga0068302_10127312 Ga0068302_101273122 461
25 3300042590 Ga0466690_423985 Ga0466690_423985_671_2146 461
26 3300042593 Ga0466691_063953 Ga0466691_063953_1820_3256 461
27 3300042655 Ga0466727_234492 Ga0466727_234492_2355_3842 461
28 3300042590 Ga0466690_034154 Ga0466690_034154_567_2042 462
29 3300042643 Ga0466704_127151 Ga0466704_127151_38_1534 467
30 3300042590 Ga0466690_396645 Ga0466690_396645_10844_12271 469
31 3300042592 Ga0466693_056569 Ga0466693_056569_877_2304 469
32 3300042615 Ga0466711_399830 Ga0466711_399830_706_2130 469
33 3300042620 Ga0466728_088604 Ga0466728_088604_29042_30469 469
34 3300042643 Ga0466704_086836 Ga0466704_086836_3643_5073 469
35 3300042643 Ga0466704_289330 Ga0466704_289330_7441_8871 469
36 3300042602 Ga0466713_138099 Ga0466713_138099_4956_6368 470
37 3300010882 Ga0123354_10004445 Ga0123354_100044459 471
38 3300042593 Ga0466691_205213 Ga0466691_205213_16335_17750 471
39 3300042621 Ga0466729_288296 Ga0466729_288296_29_1480 471
40 3300042596 Ga0466696_237105 Ga0466696_237105_3506_4924 472
41 3300042604 Ga0466717_298133 Ga0466717_298133_25_1443 472
42 3300042609 Ga0466722_007565 Ga0466722_007565_8261_9679 472
43 3300042609 Ga0466722_096172 Ga0466722_096172_6417_7835 472
44 3300042609 Ga0466722_146298 Ga0466722_146298_19253_20671 472
45 3300042655 Ga0466727_227555 Ga0466727_227555_7558_8976 472
46 3300010167 Ga0123353_10003561 Ga0123353_1000356113 473
47 3300042591 Ga0466692_183492 Ga0466692_183492_7195_8616 473
48 3300042601 Ga0466707_391793 Ga0466707_391793_1336_2757 473
49 3300042605 Ga0466716_139295 Ga0466716_139295_13752_15173 473
50 3300042612 Ga0466705_102543 Ga0466705_102543_570_1991 473
51 3300042615 Ga0466711_413937 Ga0466711_413937_3333_4754 473
52 3300042616 Ga0466715_509459 Ga0466715_509459_6776_8197 473
53 3300042618 Ga0466723_277956 Ga0466723_277956_16904_18325 473
54 3300042624 Ga0466735_103197 Ga0466735_103197_26_1447 473
55 3300042655 Ga0466727_225007 Ga0466727_225007_71_1492 473
56 3300042659 Ga0466733_025776 Ga0466733_025776_23170_24591 473
57 iso_pr_bacteria 2940202316 2940204781 473
58 iso_pr_bacteria 2940205530 2940205641 473
59 iso_pr_bacteria 2940212447 2940212558 473
60 iso_pr_bacteria 2940298504 2940298615 473
61 iso_pr_bacteria 2940302308 2940302419 473
62 iso_pr_bacteria 2940306115 2940306548 473
63 iso_pr_bacteria 2940309933 2940310470 473
64 iso_pr_bacteria 2940313741 2940314281 473
65 iso_pr_bacteria 2940317558 2940318095 473
66 iso_pr_bacteria 2940321370 2940321802 473
67 iso_pr_bacteria 2940325180 2940325465 473
68 iso_pr_bacteria 2940328985 2940329271 473
69 iso_pr_bacteria 2940332795 2940333228 473
70 2225789004 2227122483 2227516089 474
71 3300005071 Ga0068302_10018419 Ga0068302_100184191 474
72 3300005201 Ga0072941_1240440 Ga0072941_12404402 474
73 3300010049 Ga0123356_10183353 Ga0123356_101833532 474
74 3300042550 Ga0466656_352580 Ga0466656_352580_4655_6079 474
75 3300042593 Ga0466691_017241 Ga0466691_017241_3374_4798 474
76 3300042599 Ga0466706_156991 Ga0466706_156991_14851_16275 474
77 3300042601 Ga0466707_135525 Ga0466707_135525_1738_3162 474
78 3300042602 Ga0466713_032013 Ga0466713_032013_55279_56703 474
79 3300042602 Ga0466713_048578 Ga0466713_048578_473_1897 474
80 3300042604 Ga0466717_225618 Ga0466717_225618_185_1609 474
81 3300042609 Ga0466722_021369 Ga0466722_021369_526_1950 474
82 3300042615 Ga0466711_114294 Ga0466711_114294_9240_10664 474
83 3300042636 Ga0466703_411361 Ga0466703_411361_2758_4182 474
84 2225789004 2227594072 2228155500 475
85 3300002462 JGI24702J35022_10002397 JGI24702J35022_100023973 475
86 3300002462 JGI24702J35022_10005414 JGI24702J35022_100054144 475
87 3300005083 Ga0068305_10027801 Ga0068305_1002780111 475
88 3300005083 Ga0068305_10178469 Ga0068305_101784691 475
89 3300042590 Ga0466690_104588 Ga0466690_104588_4474_5901 475
90 3300042593 Ga0466691_113066 Ga0466691_113066_4055_5482 475
91 3300042596 Ga0466696_051573 Ga0466696_051573_4791_6218 475
92 3300042596 Ga0466696_124171 Ga0466696_124171_2223_3650 475
93 3300042596 Ga0466696_345561 Ga0466696_345561_2682_4109 475
94 3300042601 Ga0466707_250647 Ga0466707_250647_4575_6002 475
95 3300042605 Ga0466716_165629 Ga0466716_165629_10134_11561 475
96 3300042606 Ga0466719_165306 Ga0466719_165306_1157_2584 475
97 3300042616 Ga0466715_017045 Ga0466715_017045_19845_21272 475
98 3300042618 Ga0466723_033742 Ga0466723_033742_15140_16567 475
99 3300042643 Ga0466704_128682 Ga0466704_128682_10576_12003 475
100 3300042648 Ga0466709_062466 Ga0466709_062466_2896_4323 475
101 3300042648 Ga0466709_072784 Ga0466709_072784_573_2000 475
102 3300042655 Ga0466727_238916 Ga0466727_238916_12515_13942 475
103 3300042659 Ga0466733_015565 Ga0466733_015565_13779_15206 475
104 3300042599 Ga0466706_014807 Ga0466706_014807_6819_8249 476
105 3300042602 Ga0466713_045837 Ga0466713_045837_3561_4991 476
106 3300042606 Ga0466719_231747 Ga0466719_231747_1971_3401 476
107 3300042609 Ga0466722_086939 Ga0466722_086939_135_1565 476
108 3300042620 Ga0466728_357481 Ga0466728_357481_16630_18108 476
109 3300042643 Ga0466704_068446 Ga0466704_068446_10383_11813 476
110 3300042655 Ga0466727_147874 Ga0466727_147874_639_2069 476
111 3300042590 Ga0466690_023696 Ga0466690_023696_3956_5389 477
112 3300042590 Ga0466690_040127 Ga0466690_040127_55_1488 477
113 3300042605 Ga0466716_431653 Ga0466716_431653_11747_13180 477
114 3300042612 Ga0466705_120457 Ga0466705_120457_860_2293 477
115 3300042636 Ga0466703_015658 Ga0466703_015658_3262_4695 477
116 3300042652 Ga0466708_034593 Ga0466708_034593_10584_12017 477
117 3300042654 Ga0466725_094720 Ga0466725_094720_947_2380 477
118 3300002504 JGI24705J35276_12237825 JGI24705J35276_122378252 478
119 3300002834 JGI24696J40584_12955541 JGI24696J40584_129555412 478
120 3300010049 Ga0123356_10087362 Ga0123356_100873622 478
121 3300042602 Ga0466713_027482 Ga0466713_027482_4991_6427 478
122 3300042616 Ga0466715_621077 Ga0466715_621077_3705_5141 478
123 3300042636 Ga0466703_057079 Ga0466703_057079_1134_2570 478
124 3300042616 Ga0466715_459244 Ga0466715_459244_13988_15427 479
125 3300042643 Ga0466704_018563 Ga0466704_018563_93_1532 479
126 3300042590 Ga0466690_433741 Ga0466690_433741_1630_3072 480
127 3300042606 Ga0466719_240642 Ga0466719_240642_6287_7729 480
128 3300042609 Ga0466722_265821 Ga0466722_265821_4732_6177 481
129 3300042652 Ga0466708_090904 Ga0466708_090904_58469_59914 481
130 3300042655 Ga0466727_083853 Ga0466727_083853_3500_4945 481
131 3300042593 Ga0466691_051621 Ga0466691_051621_2847_4295 482
132 3300042596 Ga0466696_057705 Ga0466696_057705_584_2032 482
133 3300042636 Ga0466703_039989 Ga0466703_039989_1773_3257 482
134 3300042659 Ga0466733_099812 Ga0466733_099812_3650_5098 482
135 3300042643 Ga0466704_610574 Ga0466704_610574_890_2341 483
136 3300042596 Ga0466696_204542 Ga0466696_204542_2632_4086 484
137 3300042599 Ga0466706_133122 Ga0466706_133122_27019_28473 484
138 3300042612 Ga0466705_158665 Ga0466705_158665_16455_17909 484
139 3300042654 Ga0466725_365748 Ga0466725_365748_3005_4462 485
140 3300000062 IMNBL1DRAFT_c0003022 IMNBL1DRAFT_00030226 487
141 3300042609 Ga0466722_023454 Ga0466722_023454_3454_4941 487
142 3300042612 Ga0466705_100268 Ga0466705_100268_6251_7714 487
143 3300042622 Ga0466731_315388 Ga0466731_315388_55_1518 487
144 3300042643 Ga0466704_063074 Ga0466704_063074_3686_5149 487
145 iso_pr_bacteria 2695420317 2695486137 487
146 iso_pr_bacteria 2873600114 2873600244 487
147 iso_pr_bacteria 2873610414 2873610617 487
148 iso_pr_bacteria 8100157865 8100159819 487
149 3300042624 Ga0466735_217199 Ga0466735_217199_298_1764 488
150 3300010882 Ga0123354_10038965 Ga0123354_100389653 490
151 3300042593 Ga0466691_105872 Ga0466691_105872_3678_5150 490
152 3300042601 Ga0466707_204250 Ga0466707_204250_7168_8640 490
153 3300042615 Ga0466711_007932 Ga0466711_007932_1308_2780 490
154 3300042648 Ga0466709_013081 Ga0466709_013081_12316_13788 490
155 iso_pr_bacteria 2910930387 2910930673 490
156 2225789004 2227631843 2228216392 491
157 3300042596 Ga0466696_079205 Ga0466696_079205_938_2413 491
158 3300042596 Ga0466696_227581 Ga0466696_227581_6403_7878 491
159 3300042597 Ga0466699_370256 Ga0466699_370256_390_1865 491
160 3300042609 Ga0466722_210324 Ga0466722_210324_874_2349 491
161 3300042612 Ga0466705_133193 Ga0466705_133193_6817_8292 491
162 3300042612 Ga0466705_271246 Ga0466705_271246_4229_5704 491
163 3300042615 Ga0466711_325608 Ga0466711_325608_1949_3424 491
164 3300042618 Ga0466723_333646 Ga0466723_333646_5049_6524 491
165 3300042636 Ga0466703_037252 Ga0466703_037252_142_1617 491
166 3300042636 Ga0466703_037385 Ga0466703_037385_148_1623 491
167 3300042643 Ga0466704_175652 Ga0466704_175652_1812_3287 491
168 3300042643 Ga0466704_204223 Ga0466704_204223_9037_10512 491
169 iso_pr_bacteria 2820746860 2820746989 491
170 3300000062 IMNBL1DRAFT_c0003965 IMNBL1DRAFT_00039653 492
171 3300042599 Ga0466706_141606 Ga0466706_141606_422_1900 492
172 3300042636 Ga0466703_242236 Ga0466703_242236_1275_2753 492
173 3300042602 Ga0466713_129978 Ga0466713_129978_21037_22518 493
174 3300042603 Ga0466714_059757 Ga0466714_059757_47043_48524 493
175 3300042621 Ga0466729_168096 Ga0466729_168096_2967_4448 493
176 3300042652 Ga0466708_168646 Ga0466708_168646_80_1561 493
177 3300042659 Ga0466733_098937 Ga0466733_098937_97111_98592 493
178 iso_pr_bacteria 2695420931 2698108949 493
179 3300042596 Ga0466696_463796 Ga0466696_463796_13036_14520 494
180 3300042624 Ga0466735_234793 Ga0466735_234793_423_1907 494
181 3300042655 Ga0466727_196576 Ga0466727_196576_57601_59085 494
182 iso_pr_bacteria 2967483437 2967487198 494
183 3300042603 Ga0466714_170196 Ga0466714_170196_436_1926 496
184 3300042624 Ga0466735_186780 Ga0466735_186780_25_1518 497
185 3300005083 Ga0068305_10320943 Ga0068305_103209435 498
186 3300042621 Ga0466729_190457 Ga0466729_190457_108_1604 498
187 3300042636 Ga0466703_301439 Ga0466703_301439_6012_7511 499
188 3300042643 Ga0466704_320799 Ga0466704_320799_1525_3024 499
189 3300042621 Ga0466729_302522 Ga0466729_302522_2185_3687 500
190 3300042655 Ga0466727_130463 Ga0466727_130463_2004_3512 502
191 3300042596 Ga0466696_115451 Ga0466696_115451_405_1922 505
192 3300042602 Ga0466713_113316 Ga0466713_113316_27438_28955 505
193 3300042591 Ga0466692_046708 Ga0466692_046708_94572_96164 514
194 3300042602 Ga0466713_110857 Ga0466713_110857_7077_8621 514
195 3300042618 Ga0466723_006640 Ga0466723_006640_3046_4707 553

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain 335 527 0.98
PF00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain 84 325 0.92

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.