Protein Family IF07977

Metagenome Isolate
109 Members
46 Samples
106 Scaffolds
167.38 Avg Length

🧬 Representative Sequence

ID
3300042618|Ga0466723_002191|Ga0466723_002191_2140_2727
Length
195 aa
Sequence
MMERVPKADVLERLRHLKNQGESMKKFVTGICLFIFIGGFCFALDPAEGYWLSVDDKTGKVTAGWEIYQEGGKLYGKVLSTAEHAPDVKAERCKESYRGFPVAGKVNHMTVAGTPWIFGLSREQEGRWGNGNVIDPTDGNMYKCRITYHPADGTRFTVDTLEMRGEIGLGIGRSQFWRKTNRETAASQSPLLSGK

📊 Sample Types

Isolate 1.8%
Metagenome 98.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 46.5%
Kalotermitidae 27.9%
Rhinotermitidae 9.3%
Unclassified 9.3%
Termopsidae 7.0%

🌳 Taxonomy

Archaea 0
Bacteria 88
Eukaryota 0
Viruses 0
Unclassified 21

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
10 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
11 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
12 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
13 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
14 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
15 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
16 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
17 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
18 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
19 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
22 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
23 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
24 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
25 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
26 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
29 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
30 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
31 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
32 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
33 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
34 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
35 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
36 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
37 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
38 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
39 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
40 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
41 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
42 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
43 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
44 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
45 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
46 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_11004532 3300010049 Bacteria 1004
2 JGI24698J34947_10036502 3300002449 Bacteria 2559
3 JGI24698J34947_10056663 3300002449 Bacteria 1947
4 JGI24702J35022_10004716 3300002462 Bacteria 8074
5 Ga0072941_1007462 3300005201 Bacteria 5332
6 Ga0466712_189024 3300042614 Bacteria 6761
7 Ga0466731_193261 3300042622 Bacteria 1198
8 Ga0466731_338535 3300042622 Bacteria 1883
9 Ga0466735_139617 3300042624 Bacteria 1982
10 Ga0466708_035113 3300042652 Bacteria 8518
11 Ga0466708_175939 3300042652 Bacteria 8474
12 Ga0466713_118543 3300042602 Bacteria 2119
13 Ga0123354_10443219 3300010882 Bacteria 1058
14 AustNasuHG_c1002653 3300000089 Bacteria 6459
15 JGI24695J34938_10001733 3300002450 Bacteria 18026
16 Ga0072941_1006570 3300005201 Bacteria 8099
17 Ga0466726_019961 3300042619 Bacteria 16065
18 Ga0466690_007099 3300042590 Bacteria 1091
19 Ga0466703_135532 3300042636 Bacteria 17111
20 Ga0466704_272531 3300042643 Bacteria 15353
21 Ga0466727_346548 3300042655 Bacteria 1965
22 Ga0466716_209113 3300042605 Bacteria 6622
23 Ga0466720_116563 3300042607 Bacteria 12830
24 Ga0466705_130696 3300042612 Unclassified 1218
25 Ga0123353_10522713 3300010167 Bacteria 1721
26 JGI24698J34947_10057701 3300002449 Unclassified 1925
27 Ga0466712_022227 3300042614 Bacteria 1143
28 Ga0466712_076328 3300042614 Bacteria 8339
29 Ga0466711_297018 3300042615 Bacteria 6417
30 Ga0466715_407483 3300042616 Bacteria 3440
31 Ga0466726_444418 3300042619 Unclassified 1330
32 Ga0466690_159787 3300042590 Bacteria 3322
33 Ga0466692_129340 3300042591 Bacteria 5526
34 Ga0466708_116276 3300042652 Bacteria 1412
35 Ga0123356_12200394 3300010049 Unclassified 689
36 JGI24698J34947_10007568 3300002449 Bacteria 5967
37 JGI24699J35502_11129483 3300002509 Unclassified 4725
38 Ga0466712_034458 3300042614 Bacteria 3297
39 Ga0466712_174442 3300042614 Bacteria 1493
40 Ga0466715_072653 3300042616 Bacteria 9131
41 Ga0466723_002191 3300042618 Bacteria 4543
42 Ga0264413_100605 3300024493 Bacteria 14161
43 Ga0264413_110103 3300024493 Bacteria 1492
44 Ga0466692_060919 3300042591 Bacteria 3864
45 Ga0466692_097469 3300042591 Bacteria 1708
46 Ga0466700_381992 3300042600 Bacteria 2001
47 Ga0466720_174976 3300042607 Bacteria 2013
48 Ga0466722_064517 3300042609 Bacteria 1457
49 FAAS_10274978 3300001880 Unclassified 579
50 JGI24698J34947_10001810 3300002449 Bacteria 11401
51 JGI24698J34947_10070024 3300002449 Unclassified 1690
52 Ga0466712_233067 3300042614 Unclassified 1179
53 Ga0466718_164930 3300042617 Bacteria 9550
54 Ga0466726_326357 3300042619 Bacteria 2798
55 Ga0466726_342361 3300042619 Unclassified 1248
56 Ga0466709_345135 3300042648 Bacteria 5134
57 Ga0466727_214296 3300042655 Unclassified 1035
58 Ga0466720_168324 3300042607 Unclassified 1112
59 Ga0123353_11013270 3300010167 Unclassified 1114
60 AustNasuHG_c1022798 3300000089 Bacteria 2007
61 JGI24698J34947_10090319 3300002449 Bacteria 1407
62 Ga0466711_086582 3300042615 Bacteria 7115
63 Ga0466718_002045 3300042617 Bacteria 9899
64 Ga0466718_079081 3300042617 Bacteria 1280
65 Ga0466723_128742 3300042618 Bacteria 5408
66 Ga0466726_232415 3300042619 Bacteria 4791
67 Ga0466728_432041 3300042620 Bacteria 2942
68 Ga0264413_117098 3300024493 Bacteria 9056
69 Ga0466692_023113 3300042591 Bacteria 2809
70 Ga0466692_120950 3300042591 Bacteria 8863
71 Ga0466692_142270 3300042591 Bacteria 2352
72 Ga0466699_034601 3300042597 Bacteria 1732
73 Ga0466703_080395 3300042636 Unclassified 1075
74 Ga0466704_141373 3300042643 Bacteria 1434
75 Ga0466708_162467 3300042652 Bacteria 15143
76 Ga0466720_014024 3300042607 Bacteria 1270
77 Ga0466722_025176 3300042609 Unclassified 1091
78 Ga0466698_394898 3300042610 Bacteria 2812
79 Ga0466733_045250 3300042659 Bacteria 23870
80 Ga0123353_10421585 3300010167 Bacteria 1977
81 Ga0466712_245449 3300042614 Bacteria 1747
82 Ga0466712_246581 3300042614 Bacteria 2864
83 Ga0466711_026183 3300042615 Bacteria 5078
84 Ga0466715_284498 3300042616 Unclassified 1146
85 Ga0466718_083464 3300042617 Bacteria 4083
86 Ga0466718_114736 3300042617 Unclassified 1454
87 Ga0466726_481342 3300042619 Unclassified 1036
88 Ga0466729_008598 3300042621 Bacteria 1113
89 Ga0415639_025378 3300038395 Bacteria 11541
90 Ga0466694_027323 3300042594 Bacteria 1244
91 Ga0466719_039449 3300042606 Bacteria 10193
92 Ga0466720_220505 3300042607 Bacteria 26819
93 Ga0466698_083778 3300042610 Bacteria 1311
94 Ga0466732_070437 3300042656 Bacteria 5398
95 JGI24698J34947_10006489 3300002449 Unclassified 6419
96 Ga0466712_179511 3300042614 Bacteria 3282
97 Ga0466726_215669 3300042619 Bacteria 3218
98 Ga0456237_0012739 3300041968 Unclassified 1214
99 Ga0466657_194396 3300042582 Unclassified 1289
100 Ga0466690_049720 3300042590 Bacteria 2716
101 Ga0466694_162468 3300042594 Bacteria 2501
102 Ga0466731_059589 3300042622 Bacteria 1791
103 Ga0466708_057523 3300042652 Bacteria 3093
104 Ga0466727_167897 3300042655 Bacteria 1562
105 Ga0466727_328038 3300042655 Bacteria 2139
106 Ga0466707_129978 3300042601 Bacteria 2588

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002462 JGI24702J35022_10004716 JGI24702J35022_100047163 157
2 3300042622 Ga0466731_338535 Ga0466731_338535_178_675 157
3 3300042659 Ga0466733_045250 Ga0466733_045250_14871_15386 157
4 3300042652 Ga0466708_162467 Ga0466708_162467_5544_6050 158
5 iso_pr_bacteria 2781125689 2781425776 159
6 3300002509 JGI24699J35502_11129483 JGI24699J35502_111294833 160
7 3300002449 JGI24698J34947_10036502 JGI24698J34947_100365023 161
8 3300024493 Ga0264413_110103 Ga0264413_1101032 161
9 3300042607 Ga0466720_116563 Ga0466720_116563_7779_8264 161
10 3300042607 Ga0466720_174976 Ga0466720_174976_1102_1587 161
11 3300042607 Ga0466720_220505 Ga0466720_220505_13592_14077 161
12 3300042610 Ga0466698_083778 Ga0466698_083778_10_516 161
13 3300001880 FAAS_10274978 FAAS_102749781 162
14 3300042607 Ga0466720_014024 Ga0466720_014024_358_846 162
15 3300042607 Ga0466720_168324 Ga0466720_168324_272_760 162
16 3300042616 Ga0466715_407483 Ga0466715_407483_230_721 163
17 3300042643 Ga0466704_141373 Ga0466704_141373_701_1192 163
18 3300042594 Ga0466694_027323 Ga0466694_027323_420_914 164
19 3300042612 Ga0466705_130696 Ga0466705_130696_203_697 164
20 3300042617 Ga0466718_164930 Ga0466718_164930_3633_4127 164
21 3300010049 Ga0123356_11004532 Ga0123356_110045322 165
22 3300042617 Ga0466718_114736 Ga0466718_114736_767_1264 165
23 3300042619 Ga0466726_019961 Ga0466726_019961_13971_14468 165
24 3300042619 Ga0466726_215669 Ga0466726_215669_2394_2891 165
25 3300042622 Ga0466731_059589 Ga0466731_059589_846_1343 165
26 3300042643 Ga0466704_272531 Ga0466704_272531_935_1432 165
27 3300042652 Ga0466708_057523 Ga0466708_057523_1542_2039 165
28 3300042652 Ga0466708_116276 Ga0466708_116276_603_1100 165
29 3300042655 Ga0466727_328038 Ga0466727_328038_1210_1707 165
30 3300000089 AustNasuHG_c1022798 AustNasuHG_10227984 166
31 3300002449 JGI24698J34947_10001810 JGI24698J34947_1000181012 166
32 3300002449 JGI24698J34947_10070024 JGI24698J34947_100700242 166
33 3300042590 Ga0466690_049720 Ga0466690_049720_2072_2572 166
34 3300042590 Ga0466690_159787 Ga0466690_159787_2436_2936 166
35 3300042597 Ga0466699_034601 Ga0466699_034601_447_947 166
36 3300042602 Ga0466713_118543 Ga0466713_118543_1523_2023 166
37 3300042605 Ga0466716_209113 Ga0466716_209113_5901_6401 166
38 3300042614 Ga0466712_022227 Ga0466712_022227_325_825 166
39 3300042614 Ga0466712_179511 Ga0466712_179511_257_757 166
40 3300042614 Ga0466712_233067 Ga0466712_233067_358_858 166
41 3300042615 Ga0466711_297018 Ga0466711_297018_5590_6090 166
42 3300042617 Ga0466718_079081 Ga0466718_079081_509_1009 166
43 3300042619 Ga0466726_326357 Ga0466726_326357_183_683 166
44 3300042619 Ga0466726_342361 Ga0466726_342361_401_901 166
45 3300042619 Ga0466726_481342 Ga0466726_481342_15_515 166
46 3300042620 Ga0466728_432041 Ga0466728_432041_734_1234 166
47 3300042624 Ga0466735_139617 Ga0466735_139617_698_1198 166
48 3300042655 Ga0466727_167897 Ga0466727_167897_162_662 166
49 3300042655 Ga0466727_214296 Ga0466727_214296_429_929 166
50 3300002449 JGI24698J34947_10057701 JGI24698J34947_100577014 167
51 3300005201 Ga0072941_1006570 Ga0072941_10065703 167
52 3300010167 Ga0123353_10421585 Ga0123353_104215852 167
53 3300042582 Ga0466657_194396 Ga0466657_194396_181_684 167
54 3300042582 Ga0466657_194396 Ga0466657_194396_717_1220 167
55 3300042594 Ga0466694_162468 Ga0466694_162468_578_1081 167
56 3300042610 Ga0466698_394898 Ga0466698_394898_257_760 167
57 3300042615 Ga0466711_026183 Ga0466711_026183_2791_3294 167
58 3300042616 Ga0466715_072653 Ga0466715_072653_5558_6061 167
59 3300042617 Ga0466718_083464 Ga0466718_083464_3314_3817 167
60 3300042619 Ga0466726_444418 Ga0466726_444418_229_732 167
61 3300042648 Ga0466709_345135 Ga0466709_345135_633_1136 167
62 3300042655 Ga0466727_346548 Ga0466727_346548_58_561 167
63 3300010049 Ga0123356_12200394 Ga0123356_122003941 168
64 3300010167 Ga0123353_10522713 Ga0123353_105227132 168
65 3300041968 Ga0456237_0012739 Ga0456237_0012739_389_895 168
66 3300042591 Ga0466692_023113 Ga0466692_023113_265_771 168
67 3300042591 Ga0466692_060919 Ga0466692_060919_188_694 168
68 3300042614 Ga0466712_034458 Ga0466712_034458_2596_3102 168
69 3300042614 Ga0466712_076328 Ga0466712_076328_5084_5590 168
70 3300042614 Ga0466712_189024 Ga0466712_189024_1451_1972 168
71 3300042614 Ga0466712_246581 Ga0466712_246581_1741_2265 168
72 3300042615 Ga0466711_086582 Ga0466711_086582_361_867 168
73 3300042617 Ga0466718_002045 Ga0466718_002045_3626_4132 168
74 iso_pr_bacteria 2781125696 2781440401 168
75 3300000089 AustNasuHG_c1002653 AustNasuHG_10026534 169
76 3300002449 JGI24698J34947_10006489 JGI24698J34947_100064896 169
77 3300002449 JGI24698J34947_10007568 JGI24698J34947_100075685 169
78 3300002449 JGI24698J34947_10056663 JGI24698J34947_100566634 169
79 3300002449 JGI24698J34947_10090319 JGI24698J34947_100903193 169
80 3300010882 Ga0123354_10443219 Ga0123354_104432192 169
81 3300042591 Ga0466692_097469 Ga0466692_097469_163_672 169
82 3300042591 Ga0466692_120950 Ga0466692_120950_4575_5084 169
83 3300042591 Ga0466692_129340 Ga0466692_129340_2781_3290 169
84 3300042591 Ga0466692_142270 Ga0466692_142270_363_872 169
85 3300042609 Ga0466722_064517 Ga0466722_064517_898_1407 169
86 3300042621 Ga0466729_008598 Ga0466729_008598_431_940 169
87 3300042652 Ga0466708_175939 Ga0466708_175939_1081_1593 170
88 3300042600 Ga0466700_381992 Ga0466700_381992_697_1212 171
89 3300042609 Ga0466722_025176 Ga0466722_025176_243_758 171
90 3300042614 Ga0466712_245449 Ga0466712_245449_524_1039 171
91 3300042656 Ga0466732_070437 Ga0466732_070437_3184_3699 171
92 3300005201 Ga0072941_1007462 Ga0072941_10074622 172
93 3300038395 Ga0415639_025378 Ga0415639_025378_9599_10117 172
94 3300042590 Ga0466690_007099 Ga0466690_007099_416_934 172
95 3300042601 Ga0466707_129978 Ga0466707_129978_838_1356 172
96 3300042606 Ga0466719_039449 Ga0466719_039449_7688_8206 172
97 3300042616 Ga0466715_284498 Ga0466715_284498_105_623 172
98 3300042618 Ga0466723_128742 Ga0466723_128742_1890_2408 172
99 3300042622 Ga0466731_193261 Ga0466731_193261_131_649 172
100 3300042636 Ga0466703_080395 Ga0466703_080395_188_706 172
101 3300042652 Ga0466708_035113 Ga0466708_035113_1080_1598 172
102 3300002450 JGI24695J34938_10001733 JGI24695J34938_1000173311 173
103 3300042619 Ga0466726_232415 Ga0466726_232415_1402_1923 173
104 3300042636 Ga0466703_135532 Ga0466703_135532_3562_4083 173
105 3300010167 Ga0123353_11013270 Ga0123353_110132702 174
106 3300042614 Ga0466712_174442 Ga0466712_174442_904_1428 174
107 3300024493 Ga0264413_117098 Ga0264413_1170987 179
108 3300024493 Ga0264413_100605 Ga0264413_1006056 191
109 3300042618 Ga0466723_002191 Ga0466723_002191_2140_2727 195

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF09917 DUF2147 Uncharacterized protein conserved in bacteria (DUF2147) 49 178 0.89

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
4inn-assembly1.cif.gz_A Protein HP1028 from the human pathogen Helicobacter pylori belongs to the lipocalin family 0.828 43 184
2ys5-assembly1.cif.gz_A Solution structure of the complex of the PTB domain of SNT-2 and 19-residue peptide (aa 1571-1589) of hALK 0.607 46 76
5iso-assembly2.cif.gz_C STRUCTURE OF FULL LENGTH HUMAN AMPK (NON-PHOSPHORYLATED AT T-LOOP) IN COMPLEX WITH A SMALL MOLECULE ACTIVATOR, A BENZIMIDAZOLE DERIVATIVE (991) 0.584 118 173
7tom-assembly1.cif.gz_A X-ray crystal structure of glycerol dibiphytanyl glycerol tetraether - macrocyclic archaeol synthase (GDGT-MAS) from Methanocaldococcus jannaschii with bacterial lipid substrate analog, 5'deoxyadenosine, and methionine bound 0.565 48 85
7tol-assembly1.cif.gz_A X-ray crystal structure of glycerol dibiphytanyl glycerol tetraether - macrocyclic archaeol synthase (GDGT-MAS) from Methanocaldococcus jannaschii with archaeal lipid, 5'deoxyadenosine, and methionine bound 0.556 48 85
IDDescriptionScoreStartEndSuperfamily
4innA00 Mainly Beta;Beta Barrel;Lipocalin; 0.8369 43 184 2.40.128.520
af_G5EDB9_453_586_1.20.870.10 Mainly Alpha;Up-down Bundle;Son of sevenless (SoS) protein; Chain S, domain 1;Son of sevenless (SoS) protein Chain: S domain 1 0.7418 52 83 1.20.870.10
af_A0A0R4IGR0_46_179_3.40.630.60 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase; 0.7285 144 181 3.40.630.60
2ys5A01 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6383 49 76 2.30.29.30
2j0pA02 Alpha Beta;3-Layer(aba) Sandwich;Heme iron utilization protein-like fold;HemS/ChuS/ChuX like domains 0.5882 143 182 3.40.1570.10
IDDescriptionScoreStartEndGO Terms
AF-I0XBM2-F1-model_v4 Uncharacterized/unreviewed 0.9452 36 187

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.